Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RLN1/Relaxin-1, Human (HEK293, His)

The RLN1/Relaxin-1 protein is an important ovarian hormone that cooperates with estrogen to induce birth canal dilation. It plays a vital role in connective tissue remodeling during pregnancy, promoting pubic ligament growth and cervical ripening. RLN1/Relaxin-1 Protein, Human (HEK293, His) is the recombinant human-derived RLN1/Relaxin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RLN1/Relaxin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rln1-relaxin-1-protein-human-hek293-his.html

Purity

90.40

Smiles

VAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC

Molecular Formula

6013 (Gene_ID) P04808 (V23-C185) (Accession)

Molecular Weight

Approximately 20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Rat Interleukin 4 Receptor (IL4R) Polyclonal Antibody
VD2N998 1 Each

Rabbit Anti-Rat Interleukin 4 Receptor (IL4R) Polyclonal Antibody

Sign In for Pricing
View Details
Safranin O Solution (For Gram Staining)
SOG250 250 mL

Safranin O Solution (For Gram Staining)

Sign In for Pricing
View Details
Pfn2 Rat shRNA Plasmid (Locus ID 81531)
TL711116 1 Kit

Pfn2 Rat shRNA Plasmid (Locus ID 81531)

Sign In for Pricing
View Details
SLC18A1 cDNA Clone
MBS1267314-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

SLC18A1 cDNA Clone

Sign In for Pricing
View Details
SLC18A1 cDNA Clone
MBS1267314-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

SLC18A1 cDNA Clone

Sign In for Pricing
View Details
Mouse Bcat2 (NM_009737) AAV Particle
MR206133A1V 250 µL

Mouse Bcat2 (NM_009737) AAV Particle

Sign In for Pricing
View Details