Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOG, Human (His-SUMO)

NANOG Protein, Human (His-SUMO) which functions to maintain the undifferentiated state of pluripotent stem cells.

Product Specifications

Product Name Alternative

NANOG Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nanog-protein-human-his-sumo.html

Purity

90.0

Smiles

MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVGGYGRKKRRQRRR

Molecular Formula

79923 (Gene_ID) Q9H9S0-1 (M1-V305) (Accession)

Molecular Weight

Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Münst B, et al. Nanog induces suppression of senescence through downregulation of p27KIP1 expression. J Cell Sci. 2016 Mar 1;129 (5) :912-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPAIN Mouse Monoclonal Antibody [Clone ID: OTI6A7]
CF810560 100 µg

RPAIN Mouse Monoclonal Antibody [Clone ID: OTI6A7]

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS806291 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Protonex™ Red 670 acid
21181-AAT 1 mg

Protonex™ Red 670 acid

Sign In for Pricing
View Details
IGBP1P1 Human qPCR Primer Pair (NR_002937)
HP220229 200 Reactions

IGBP1P1 Human qPCR Primer Pair (NR_002937)

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), 0.2mg/mL
BNUB0266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), 0.2mg/mL

Sign In for Pricing
View Details
PAX5 Human Gene Knockout Kit (CRISPR)
KN222785RB 1 Kit

PAX5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details