Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOG, Human (His-SUMO)

NANOG Protein, Human (His-SUMO) which functions to maintain the undifferentiated state of pluripotent stem cells.

Product Specifications

Product Name Alternative

NANOG Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nanog-protein-human-his-sumo.html

Purity

90.0

Smiles

MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVGGYGRKKRRQRRR

Molecular Formula

79923 (Gene_ID) Q9H9S0-1 (M1-V305) (Accession)

Molecular Weight

Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Münst B, et al. Nanog induces suppression of senescence through downregulation of p27KIP1 expression. J Cell Sci. 2016 Mar 1;129 (5) :912-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-7-Amino-5H,7H-dibenzo[b,d]azepin-6-one
TRC-A604380-2.5MG 2.5 mg

(S)-7-Amino-5H,7H-dibenzo[b,d]azepin-6-one

Sign In for Pricing
View Details
Biotin Conjugated Calystega sepiem Lectin (Hedge Bindweed Rhizomes) -Calsepa-
BA-8011-1 1 mg

Biotin Conjugated Calystega sepiem Lectin (Hedge Bindweed Rhizomes) -Calsepa-

Sign In for Pricing
View Details
CLPP Antibody
KC-16859-01 50 μL

CLPP Antibody

Sign In for Pricing
View Details
CLPP Antibody
KC-16859-02 100 µL

CLPP Antibody

Sign In for Pricing
View Details
CLPP Antibody
KC-16859-03 1 mL

CLPP Antibody

Sign In for Pricing
View Details
LAP3 Recombinant Rabbit Monoclonal Antibody [PSH01-26]
HA721650 100 µL

LAP3 Recombinant Rabbit Monoclonal Antibody [PSH01-26]

Sign In for Pricing
View Details