Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOG, Human (His-SUMO)

NANOG Protein, Human (His-SUMO) which functions to maintain the undifferentiated state of pluripotent stem cells.

Product Specifications

Product Name Alternative

NANOG Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nanog-protein-human-his-sumo.html

Purity

90.0

Smiles

MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVGGYGRKKRRQRRR

Molecular Formula

79923 (Gene_ID) Q9H9S0-1 (M1-V305) (Accession)

Molecular Weight

Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Münst B, et al. Nanog induces suppression of senescence through downregulation of p27KIP1 expression. J Cell Sci. 2016 Mar 1;129 (5) :912-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H3FA (HIST1H3A) Rabbit Monoclonal Antibody
TA422324 100 µL

H3FA (HIST1H3A) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CP-775146
TRC-C781355-2.5MG 2.5 mg

CP-775146

Sign In for Pricing
View Details
UNC45A (NM_001039675) Human Recombinant Protein
TP306953L 1 mg

UNC45A (NM_001039675) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS626741 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Covidyte™ TF670
13540-AAT 100 Tests

Covidyte™ TF670

Sign In for Pricing
View Details
Mouse Vamp1 activation kit by CRISPRa
GA204577 1 Kit

Mouse Vamp1 activation kit by CRISPRa

Sign In for Pricing
View Details