Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-23, Mouse (R179Q, HEK293, His)

FGF-23 protein is a key regulator that maintains phosphate homeostasis by inhibiting tubular phosphate transport and reducing SLC34A1 levels. It directly inhibits PTH secretion, regulates vitamin D metabolism, and negatively affects osteoblast differentiation and matrix mineralization. FGF-23 Protein, Mouse (R179Q, HEK293, His) is the recombinant mouse-derived FGF-23 protein, expressed by HEK293 , with C-6*His labeled tag and R179Q mutation.

Product Specifications

Product Name Alternative

FGF-23 Protein, Mouse (R179Q, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-23-protein-mouse-hek293-his.html

Purity

96.00

Smiles

YPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFRQWTLENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTQSAEDPPERDPLNVLKPRPRATPVPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARGGAGGADRCRPFPRFV

Molecular Formula

64654 (Gene_ID) Q9EPC2 (Y25-V251, R179Q) (Accession)

Molecular Weight

Approximately 30-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABI2, NT (ABI2, ARGBPIA, Abl interactor 2, Abelson interactor 2, Abl-binding protein 3, Arg-binding protein 1) (FITC)
MBS6270620-01 0.2 mL

ABI2, NT (ABI2, ARGBPIA, Abl interactor 2, Abelson interactor 2, Abl-binding protein 3, Arg-binding protein 1) (FITC)

Sign In for Pricing
View Details
ABI2, NT (ABI2, ARGBPIA, Abl interactor 2, Abelson interactor 2, Abl-binding protein 3, Arg-binding protein 1) (FITC)
MBS6270620-02 5x 0.2 mL

ABI2, NT (ABI2, ARGBPIA, Abl interactor 2, Abelson interactor 2, Abl-binding protein 3, Arg-binding protein 1) (FITC)

Sign In for Pricing
View Details
AdmiRa-rno-miR-155-5p Virus
mr0560 250 µL

AdmiRa-rno-miR-155-5p Virus

Sign In for Pricing
View Details
Olfr1225 Mouse shRNA Lentiviral Particle (Locus ID 258893)
TL507939V 500 µL Each

Olfr1225 Mouse shRNA Lentiviral Particle (Locus ID 258893)

Sign In for Pricing
View Details
Cdh9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6136008 1.0 µg DNA

Cdh9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
CSK Recombinant Antibody, APC Conjugated
bsm-61019R-APC-01 20 µL

CSK Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details