IL-36 gamma/IL-1F9, Human

IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1][2]. IL-36 gamma/IL-1F9 Protein, Human is a recombinant human IL-36 gamma without any tag, which is produced in E. coli.

Product Specifications

Product Name Alternative

IL-36 gamma/IL-1F9 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-36-gamma-il-1f9-protein-human-152a-a.html

Purity

98.0

Smiles

SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Molecular Formula

56300 (Gene_ID) Q9NZH8-1 (S18-D169) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation .

References & Citations

[1]Bassoy EY, et al. Regulation and function of interleukin-36 cytokines. Immunol Rev. 2018 Jan;281 (1) :169-178.|[2]Zhou L, et al. Interleukin-36: Structure, Signaling and Function. Adv Exp Med Biol. 2021;21:191-210.|[3]Gresnigt MS, et al. Biology of IL-36 cytokines and their role in disease. Semin Immunol. 2013 Dec 15;25 (6) :458-65.|[4]Neurath MF. IL-36 in chronic inflammation and cancer. Cytokine Growth Factor Rev. 2020 Oct;55:70-79.|[5]Xu P, et al. The mechanism on Prevotella melaninogenica promoting the inflammatory progression of oral lichen planus. Clin Exp Immunol. 2022 Aug 19;209 (2) :215-224.|[6]Le N, Luk I, et al. IL-36G promotes cancer-cell intrinsic hallmarks in human gastric cancer cells. Cytokine. 2022 Jul;155:155887.