Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYVE-1, Human (HEK293, His)

The LYVE-1 protein is a ligand-specific transporter that regulates molecular transport between the trans-Golgi network (TGN) and the plasma membrane. It plays a key role in autocrine cell growth regulation, mediating the uptake and catabolism of growth regulators through cell surface retention sequences. LYVE-1 Protein, Human (HEK293, His) is the recombinant human-derived LYVE-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LYVE-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lyve-1-protein-human-hek-293-his.html

Purity

98.0

Smiles

LVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPT

Molecular Formula

10894 (Gene_ID) AAH26231.1 (L20-T238) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TXNDC11 shRNA (UAS) - Lentiviral human TXNDC11 shRNA (UAS, RFP) (25)
GTR15078683 1 Vial

Lentiviral human TXNDC11 shRNA (UAS) - Lentiviral human TXNDC11 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Pseudomonas stutzeri Gamma-glutamyl phosphate reductase (proA)
MBS1089254-01 0.02 mg (E-Coli)

Recombinant Pseudomonas stutzeri Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details
Recombinant Pseudomonas stutzeri Gamma-glutamyl phosphate reductase (proA)
MBS1089254-02 0.02 mg (Yeast)

Recombinant Pseudomonas stutzeri Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details
Recombinant Pseudomonas stutzeri Gamma-glutamyl phosphate reductase (proA)
MBS1089254-03 0.1 mg (E-Coli)

Recombinant Pseudomonas stutzeri Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details
Recombinant Pseudomonas stutzeri Gamma-glutamyl phosphate reductase (proA)
MBS1089254-04 0.1 mg (Yeast)

Recombinant Pseudomonas stutzeri Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details
Recombinant Pseudomonas stutzeri Gamma-glutamyl phosphate reductase (proA)
MBS1089254-05 0.02 mg (Baculovirus)

Recombinant Pseudomonas stutzeri Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details