Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cystatin M/CST6, Human (HEK293, His)

Cystatin M/CST6 protein is a potent inhibitor of cathepsin L, cathepsin L2 (cathepsin V) and Legumain, regulating important proteolytic processes. It actively participates in epidermal keratinization and affects the formation of the skin barrier. Cystatin M/CST6 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin M/CST6 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Cystatin M/CST6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cystatin-m-cst6-protein-human-hek-293-his.html

Purity

98.0

Smiles

RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM

Molecular Formula

1474 (Gene_ID) Q15828 (R29-M149) (Accession)

Molecular Weight

Approximately 14.0-19.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPN13 AAV Vector (Rat) (CMV)
14993106 1 µg

CAPN13 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Recombinant Human ALKB Alkylation Repair Homolog 2
7-02458 5 µg

Recombinant Human ALKB Alkylation Repair Homolog 2

Sign In for Pricing
View Details
Hsa-miR-548p miRNA Antagomir
CIJ0807-01 10 nmol

Hsa-miR-548p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-548p miRNA Antagomir
CIJ0807-02 20 nmol

Hsa-miR-548p miRNA Antagomir

Sign In for Pricing
View Details
LMO1 Antibody (HRP)
orb240132-01 50 µg

LMO1 Antibody (HRP)

Sign In for Pricing
View Details
LMO1 Antibody (HRP)
orb240132-02 100 µg

LMO1 Antibody (HRP)

Sign In for Pricing
View Details