Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Leukemia inhibitory factor (Lif)

Product Specifications

Product Name Alternative

LIF; Cholinergic neuronal differentiation factor

Abbreviation

Recombinant Rat Lif protein

Gene Name

Lif

UniProt

P17777

Expression Region

23-202aa

Organism

Rattus norvegicus (Rat)

Target Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKSQLAQLNGSANALFISYYTAQGEPFPNNVDKLCAPNMTDFPPFHANGTEKTKLVELYRMVTYLGASLTNITWDQKNLNPTAVSLQIKLNATTDVMRGLLSSVLCRLCNKYHVGHVDVPCVPDNSSKEAFQRKKLGCQLLGTYKQVISVLAQAF

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nesprin3 (SYNE3) (C-term) Rabbit Polyclonal Antibody
AP54124PU-N 400 µL

Nesprin3 (SYNE3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pyruvate Kinase (PKLR) (NM_000298) Human Over-expression Lysate
LY400113 100 µg

Pyruvate Kinase (PKLR) (NM_000298) Human Over-expression Lysate

Sign In for Pricing
View Details
Phenyl Pentanoate
TRC-P307886-5G 5 g

Phenyl Pentanoate

Sign In for Pricing
View Details
RAP1B (NM_015646) Human Over-expression Lysate
LC402456 20 µg

RAP1B (NM_015646) Human Over-expression Lysate

Sign In for Pricing
View Details
TRK fused gene (TFG) (NM_006070) Human Over-expression Lysate
LC401827 20 µg

TRK fused gene (TFG) (NM_006070) Human Over-expression Lysate

Sign In for Pricing
View Details
Sfta2 Mouse Gene Knockout Kit (CRISPR)
KN515663 1 Kit

Sfta2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details