Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin E, Human (HEK293, His)

Cathepsin E Protein, Human (HEK293, His) is a human cathepsin E with a His tag. Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases.[1].

Product Specifications

Product Name Alternative

Cathepsin E Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-e-protein-human-hek293-his.html

Purity

95.0

Smiles

SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVPHHHHHH

Molecular Formula

1510 (Gene_ID) P14091 (S20-P396) (Accession)

Molecular Weight

Approximately 42-48 kDa

References & Citations

[1]T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells|[2]F Grüninger-Leitch, et al. Identification of beta-secretase-like activity using a mass spectrometry-based assay system. Nat Biotechnol. 2000 Jan;18 (1) :66-70.|[3]T Azuma, et al. Human gastric cathepsin E. Predicted sequence, localization to chromosome 1, and sequence homology with other aspartic proteinases. J Biol Chem

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Kinesin light chain 1 (KLC1) Rat ELISA Kit
E5376 96 Tests

Kinesin light chain 1 (KLC1) Rat ELISA Kit

Ask
View Details
AOPEP (NM_032823) Human Untagged Clone
SC126550 10 µg

AOPEP (NM_032823) Human Untagged Clone

Ask
View Details
BeyoGoldTM 15ml Centrifuge Tubes
FTUB515 25 PCS/Pack - 20 PKS/Box

BeyoGoldTM 15ml Centrifuge Tubes

Ask
View Details
Putative uncharacterized protein C14orf91 (C14orf91) Human ELISA Kit
G5657 96 Tests

Putative uncharacterized protein C14orf91 (C14orf91) Human ELISA Kit

Ask
View Details
C13orf18 Antibody (Center) Blocking peptide
MBS9225838-01 0.5 mg

C13orf18 Antibody (Center) Blocking peptide

Ask
View Details
C13orf18 Antibody (Center) Blocking peptide
MBS9225838-02 5x 0.5 mg

C13orf18 Antibody (Center) Blocking peptide

Ask
View Details