Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin E, Human (HEK293, His)

Cathepsin E Protein, Human (HEK293, His) is a human cathepsin E with a His tag. Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases.[1].

Product Specifications

Product Name Alternative

Cathepsin E Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-e-protein-human-hek293-his.html

Purity

95.0

Smiles

SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVPHHHHHH

Molecular Formula

1510 (Gene_ID) P14091 (S20-P396) (Accession)

Molecular Weight

Approximately 42-48 kDa

References & Citations

[1]T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells|[2]F Grüninger-Leitch, et al. Identification of beta-secretase-like activity using a mass spectrometry-based assay system. Nat Biotechnol. 2000 Jan;18 (1) :66-70.|[3]T Azuma, et al. Human gastric cathepsin E. Predicted sequence, localization to chromosome 1, and sequence homology with other aspartic proteinases. J Biol Chem

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cyclomaltodextrin glucanotransferase Antibody, HRP conjugated
MBS7052630-01 0.05 mg

Cyclomaltodextrin glucanotransferase Antibody, HRP conjugated

Ask
View Details
Cyclomaltodextrin glucanotransferase Antibody, HRP conjugated
MBS7052630-02 0.1 mg

Cyclomaltodextrin glucanotransferase Antibody, HRP conjugated

Ask
View Details
Cyclomaltodextrin glucanotransferase Antibody, HRP conjugated
MBS7052630-03 5x 0.1 mg

Cyclomaltodextrin glucanotransferase Antibody, HRP conjugated

Ask
View Details
ACER3, CT (Alkaline Dihydroceramidase SB89, Alkaline Phytoceramidase, aPHC, Alkaline Ceramidase 3, Alkaline CDase 3, AlkCDase 3, APHC, PHCA) (Biotin) discontinued
A2295-03R-Biotin 200 µL

ACER3, CT (Alkaline Dihydroceramidase SB89, Alkaline Phytoceramidase, aPHC, Alkaline Ceramidase 3, Alkaline CDase 3, AlkCDase 3, APHC, PHCA) (Biotin) discontinued

Ask
View Details
Defb46 (NM_001025351) Mouse Tagged Lenti ORF Clone
MR219585L3 10 µg

Defb46 (NM_001025351) Mouse Tagged Lenti ORF Clone

Ask
View Details
Helicobacter pylori [B-53.4] Ab
MBS5316891-01 0.1 mg

Helicobacter pylori [B-53.4] Ab

Ask
View Details