Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin E, Human (HEK293, His)

Cathepsin E Protein, Human (HEK293, His) is a human cathepsin E with a His tag. Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases.[1].

Product Specifications

Product Name Alternative

Cathepsin E Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-e-protein-human-hek293-his.html

Purity

95.0

Smiles

SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVPHHHHHH

Molecular Formula

1510 (Gene_ID) P14091 (S20-P396) (Accession)

Molecular Weight

Approximately 42-48 kDa

References & Citations

[1]T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells|[2]F Grüninger-Leitch, et al. Identification of beta-secretase-like activity using a mass spectrometry-based assay system. Nat Biotechnol. 2000 Jan;18 (1) :66-70.|[3]T Azuma, et al. Human gastric cathepsin E. Predicted sequence, localization to chromosome 1, and sequence homology with other aspartic proteinases. J Biol Chem

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Kallikrein 9, NT (Kallikrein-9, KLK9, Kallikrein Related Peptidase 9, Kallikrein-like Protein 3, KLKL3, KLK-L3) (FITC) discontinued
K0005-12N-FITC 200 µL

Kallikrein 9, NT (Kallikrein-9, KLK9, Kallikrein Related Peptidase 9, Kallikrein-like Protein 3, KLKL3, KLK-L3) (FITC) discontinued

Ask
View Details
Rabbit Monoclonal L1CAM Antibody (L1CAM/9146R) - Azide and BSA Free
NBP3-24102 100 µg

Rabbit Monoclonal L1CAM Antibody (L1CAM/9146R) - Azide and BSA Free

Ask
View Details
Rabbit Polyclonal Thymosin alpha 1 Antibody [Janelia Fluor 549]
NBP2-99789JF549 0.1 mL

Rabbit Polyclonal Thymosin alpha 1 Antibody [Janelia Fluor 549]

Ask
View Details
NIPSNAP1 Knockout MES-OV Polyclonal Cells
ARG5890 1 Million

NIPSNAP1 Knockout MES-OV Polyclonal Cells

Ask
View Details
Duck Guanine Nucleotide-Binding Protein G(T) Subunit Alpha-1 (GNAT1) ELISA Kit
MBS9941746 Inquire

Duck Guanine Nucleotide-Binding Protein G(T) Subunit Alpha-1 (GNAT1) ELISA Kit

Ask
View Details
NHLRC2 (AK090631) Human Untagged Clone
SC314553 10 µg

NHLRC2 (AK090631) Human Untagged Clone

Ask
View Details