Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSGA10 (Testis-specific Gene 10 Protein, CEP4L, CT79, Testis Development Protein NYD-SP7) (MaxLight 750)

Product Specifications

Gene Name

[TSGA10]

Reactivity

Human

Storage Conditions

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Specificity

Recognizes human TSGA10.

Other Gene Names

[TSGA10; CEP4L]

Short Name

[TSGA10]

Other Product Names

[testis-specific gene 10 protein isoform 1; Testis-specific gene 10 protein; Testis development protein NYD-SP7]

NCBI GI Number

13376858

NCBI Accession Number

NP_079520

NCBI GB Accession Number

NM_025244

Uniprot Accession Number

Q9BZW7

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-02 10 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
Lentiviral human SECISBP2 shRNA (UAS) - Lentiviral human SECISBP2 shRNA (UAS, GFP) (100)
GTR15306912 1 Vial

Lentiviral human SECISBP2 shRNA (UAS) - Lentiviral human SECISBP2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
TAS2R3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2333507 1.0 µg DNA

TAS2R3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Sunlong Medical™ Human LYVE-1 ELISA Kit
EL0070Hu-01 48 Tests

Sunlong Medical™ Human LYVE-1 ELISA Kit

Sign In for Pricing
View Details
Sunlong Medical™ Human LYVE-1 ELISA Kit
EL0070Hu-02 96 Tests

Sunlong Medical™ Human LYVE-1 ELISA Kit

Sign In for Pricing
View Details