Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Layilin/LAYN, Rhesus Macaque (HEK293, His)

Layilin/LAYN Protein serves as a receptor for hyaluronate and interacts with NF2, RDX, and TLN1. Layilin/LAYN Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Layilin/LAYN protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Layilin/LAYN Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/layilin-layn-protein-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

ATGRLLSGQPVCRGGTQRPCYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQNLIEKFIENLLPSDGDFWIGLRRREEKQSNSTACEDLYAWTDGSISQFRNWYVDEPSCGSEVCVVMYHQPSAPAGIGGPYMFQWNDDRCNMKNNFICKYSDEKPAVPSREPEGEETEPTTPVLLEETQEEDAKKTFKESRE

Molecular Formula

710211 (Gene_ID) F6ZPB5/XP_001105766.1 (A22-E220) (Accession)

Molecular Weight

Approximately 30-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-100 1x 100 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF647 conjugate, 0.1mg/mL
BNC470322-100 1x 100 µL

CD3e (RIV9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-500 1x 500 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (LL002), CF405S conjugate, 0.1mg/mL
BNC040499-500 1x 500 µL

Cytokeratin 14 (LL002), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details