Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Human (HEK293, His)

IL-21R protein, a receptor for interleukin-21, forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Human (HEK293, His) is the recombinant human-derived IL-21R protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-human-217a-a-hek293-his.html

Purity

99.0

Smiles

CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNP

Molecular Formula

50615 (Gene_ID) Q9HBE5 (C20-P236) (Accession)

Molecular Weight

40-55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Resistin
MBS142333-01 0.005 mg

Recombinant Mouse Resistin

Sign In for Pricing
View Details
Recombinant Mouse Resistin
MBS142333-02 0.025 mg

Recombinant Mouse Resistin

Sign In for Pricing
View Details
Recombinant Mouse Resistin
MBS142333-03 1 mg

Recombinant Mouse Resistin

Sign In for Pricing
View Details
Recombinant Mouse Resistin
MBS142333-04 5x 1 mg

Recombinant Mouse Resistin

Sign In for Pricing
View Details
KCTD12 Blocking Peptide
MBS9621119-01 1 mg

KCTD12 Blocking Peptide

Sign In for Pricing
View Details
KCTD12 Blocking Peptide
MBS9621119-02 5x 1 mg

KCTD12 Blocking Peptide

Sign In for Pricing
View Details