APOC2, Human (His, solution)
Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II deficiency[1].
Product Specifications
Product Name Alternative
APOC2 Protein, Human (His, solution), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/apolipoprotein-c-ii-protein-human-his.html
Purity
98.0
Smiles
TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEEHHHHHH
Molecular Formula
344 (Gene_ID) P02655 (T23-E101) (Accession)
Molecular Weight
Approximately 14 kDa
References & Citations
Escherichia coli
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
![BDE 31 [CAS:65075-08-3] 100ug/ml in Iso-octane](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
NPR2 (Natriuretic Peptide Receptor B/Guanylate Cyclase B (atrionatriuretic peptide Receptor B), AMDM, ANPRB, GUC2B, GUCY2B, NPRB, NPRBi) (MaxLight 490)
NPR2 (Natriuretic Peptide Receptor B/Guanylate Cyclase B (atrionatriuretic peptide Receptor B), AMDM, ANPRB, GUC2B, GUCY2B, NPRB, NPRBi) (MaxLight 490)
Heat Labile Enterotoxin (MaxLight 750) discontinued
