APOC2, Human (His, solution)
Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II deficiency[1].
Product Specifications
Product Name Alternative
APOC2 Protein, Human (His, solution), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/apolipoprotein-c-ii-protein-human-his.html
Purity
98.0
Smiles
TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEEHHHHHH
Molecular Formula
344 (Gene_ID) P02655 (T23-E101) (Accession)
Molecular Weight
Approximately 14 kDa
References & Citations
Escherichia coli
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Mouse Monoclonal SATB2 Antibody (rSATB2/8635) [HRP]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
Recombinant Clostridium thermocellum Glucose-1-phosphate adenylyltransferase (glgC)
Recombinant Clostridium thermocellum Glucose-1-phosphate adenylyltransferase (glgC)
Recombinant Clostridium thermocellum Glucose-1-phosphate adenylyltransferase (glgC)
Recombinant Clostridium thermocellum Glucose-1-phosphate adenylyltransferase (glgC)