Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOC2, Human (His, solution)

Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II deficiency[1].

Product Specifications

Product Name Alternative

APOC2 Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-c-ii-protein-human-his.html

Purity

98.0

Smiles

TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEEHHHHHH

Molecular Formula

344 (Gene_ID) P02655 (T23-E101) (Accession)

Molecular Weight

Approximately 14 kDa

References & Citations

Escherichia coli

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL17B (Interleukin 17B, IL-17B, IL-20, MGC138900, MGC138901, ZCYTO7) (MaxLight 490)
247545-ML490 100 µL

IL17B (Interleukin 17B, IL-17B, IL-20, MGC138900, MGC138901, ZCYTO7) (MaxLight 490)

Sign In for Pricing
View Details
Anti-ADK Antibody Picoband® (Carrier-free Conjugate)
PB10031-carrier-free 100 µg/Vial

Anti-ADK Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details
Interleukin 3 (IL-3) (MaxLight 750) discontinued
I7663-37A-ML750 100 µL

Interleukin 3 (IL-3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
2- ((1s,4s) -4-Phenylcyclohexyl) acetic acid
TYD-03863-01 10 mg

2- ((1s,4s) -4-Phenylcyclohexyl) acetic acid

Sign In for Pricing
View Details
2- ((1s,4s) -4-Phenylcyclohexyl) acetic acid
TYD-03863-02 50 mg

2- ((1s,4s) -4-Phenylcyclohexyl) acetic acid

Sign In for Pricing
View Details
Lentiviral human B4GALNT2 sgRNA gene knockout kit - Lentiviral human B4GALNT2 sgRNA gene knockout kit (100)
GTR15379162 1 Vial

Lentiviral human B4GALNT2 sgRNA gene knockout kit - Lentiviral human B4GALNT2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details