Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX18 (T-box Transcription Factor TBX18, T-box Protein 18) (MaxLight 550)

Product Specifications

Gene Name

[TBX18]

NCBI Gene ID

9096

Reactivity

Human, Mouse, Rat

Storage Conditions

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Specificity

Recognizes human TBX18. Species Crossreactivity: mouse and rat.

Other Gene Names

[TBX18; CAKUT2]

Short Name

[TBX18]

Other Product Names

[T-box transcription factor TBX18; T-box transcription factor 18]

NCBI GI Number

113417587

NCBI Accession Number

XM_496819

Uniprot Accession Number

NM_001080508

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD209/DC-SIGN Recombinant Antibody, PE-Cy5 Conjugated
bsm-61560R-PE-Cy5-01 20 µL

CD209/DC-SIGN Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
CD209/DC-SIGN Recombinant Antibody, PE-Cy5 Conjugated
bsm-61560R-PE-Cy5-02 100 µL

CD209/DC-SIGN Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
[KO Validated] Smad4 Rabbit pAb
E45R24196N-100 100 µL

[KO Validated] Smad4 Rabbit pAb

Sign In for Pricing
View Details
Crotamiton 500mg
A10243-500 500 mg

Crotamiton 500mg

Sign In for Pricing
View Details
Rat Monoclonal L-Selectin/CD62L Antibody (Mel-14) [Janelia Fluor 646]
NBP3-09094JF646 0.1 mL

Rat Monoclonal L-Selectin/CD62L Antibody (Mel-14) [Janelia Fluor 646]

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
MF-0155578-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details