Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Human (Biotinylated, HEK293, His-Avi)

IFN-gamma Protein is a dimeric soluble cytokine. It exerts antibacterial, antiviral and antitumor effects through JAK-STAT, mTOR, MAPK and PI3K/AKT signaling pathways. IFN-gamma Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IFN-gamma protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Molecular Formula

3458 (Gene_ID) P01579 (Q24-G161) (Accession)

Molecular Weight

Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hisamatsu H, et al. Newly identified pair of proteasomal subunits regulated reciprocally by interferon gamma. J Exp Med. 1996 Apr 1;183 (4) :1807-16.|[2]Akiyama K, et al. Replacement of proteasome subunits X and Y by LMP7 and LMP2 induced by interferon-gamma for acquirement of the functional diversity responsible for antigen processing. FEBS Lett. 1994 Apr 18;343 (1) :85-8.|[3]Platanias LC, et al. Mechanisms of type-I- and type-II-interferon-mediated signalling. Nat Rev Immunol. 2005 May;5 (5) :375-86.|[4]Bhat MY, et al A. Comprehensive network map of interferon gamma signaling. J Cell Commun Signal. 2018 Dec;12 (4) :745-751.|[5]Lah TT, et al. Gamma-interferon causes a selective induction of the lysosomal proteases, cathepsins B and L, in macrophages. FEBS Lett. 1995 Apr 17;363 (1-2) :85-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP4 (Y20) (Fatty Acid-binding Protein, Adipocyte, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4, Adipocyte Lipid-binding Protein, ALBP) (MaxLight 650)
MBS6475639-01 0.1 mL

FABP4 (Y20) (Fatty Acid-binding Protein, Adipocyte, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4, Adipocyte Lipid-binding Protein, ALBP) (MaxLight 650)

Sign In for Pricing
View Details
FABP4 (Y20) (Fatty Acid-binding Protein, Adipocyte, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4, Adipocyte Lipid-binding Protein, ALBP) (MaxLight 650)
MBS6475639-02 5x 0.1 mL

FABP4 (Y20) (Fatty Acid-binding Protein, Adipocyte, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4, Adipocyte Lipid-binding Protein, ALBP) (MaxLight 650)

Sign In for Pricing
View Details
WT1 Recombinant Rabbit mAb, PE-Cy5.5 conjugated
orb2331021 100 µL

WT1 Recombinant Rabbit mAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Sheep EFNA4 (Ephrin A4) ELISA Kit
MBS2501665-01 24 Tests

Sheep EFNA4 (Ephrin A4) ELISA Kit

Sign In for Pricing
View Details
Sheep EFNA4 (Ephrin A4) ELISA Kit
MBS2501665-02 48 Tests

Sheep EFNA4 (Ephrin A4) ELISA Kit

Sign In for Pricing
View Details
Sheep EFNA4 (Ephrin A4) ELISA Kit
MBS2501665-03 96 Tests

Sheep EFNA4 (Ephrin A4) ELISA Kit

Sign In for Pricing
View Details