Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frataxin/FXN, Human (His, Myc)

Frataxin/FXN protein activates the core iron-sulfur cluster assembly complex and accelerates sulfur transfer for [2Fe-2S] cluster assembly. It plays a key role in the de novo synthesis of clusters, delivering persulfide to the ISCU. Frataxin/FXN Protein, Human (His, Myc) is the recombinant human-derived Frataxin/FXN protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Frataxin/FXN Protein, Human (His, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frataxin-mitochondrial-fxn-human-his-myc.html

Purity

92.00

Smiles

MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

Molecular Formula

2395 (Gene_ID) Q16595-1 (M1-A210) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIPC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1218706 1.0 µg DNA

LIPC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
WTAP Antibody
E51A13323 100 µL

WTAP Antibody

Sign In for Pricing
View Details
EXOC6B, CT (EXOC6B, KIAA0919, SEC15B, SEC15L2, Exocyst complex component 6B, Exocyst complex component Sec15B, SEC15-like protein 2) (MaxLight 750)
MBS6297117-01 0.1 mL

EXOC6B, CT (EXOC6B, KIAA0919, SEC15B, SEC15L2, Exocyst complex component 6B, Exocyst complex component Sec15B, SEC15-like protein 2) (MaxLight 750)

Sign In for Pricing
View Details
EXOC6B, CT (EXOC6B, KIAA0919, SEC15B, SEC15L2, Exocyst complex component 6B, Exocyst complex component Sec15B, SEC15-like protein 2) (MaxLight 750)
MBS6297117-02 5x 0.1 mL

EXOC6B, CT (EXOC6B, KIAA0919, SEC15B, SEC15L2, Exocyst complex component 6B, Exocyst complex component Sec15B, SEC15-like protein 2) (MaxLight 750)

Sign In for Pricing
View Details
anti-ING1
YF-PA12742 100 ul

anti-ING1

Sign In for Pricing
View Details
TS-152.40-514-T-BL-20 Die-cut & Printed Numbers & Letters
121809 20 Pack (20 Label (s) x 1 Pack)

TS-152.40-514-T-BL-20 Die-cut & Printed Numbers & Letters

Sign In for Pricing
View Details