Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Protein mxiH (mxiH)

Product Specifications

Product Name Alternative

MxiH; CP0137; Protein MxiH

Abbreviation

Recombinant Shigella flexneri mxiH protein

Gene Name

MxiH

UniProt

P0A223

Expression Region

1-83aa

Organism

Shigella flexneri

Target Sequence

MSVTVPNDDWTLSSLSETFDDGTQTLQGELTLALDKLAKNPSNPQLLAEYQSKLSEYTLYRNAQSNTVKVIKDVDAAIIQNFR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.7 kDa

References & Citations

"Complete DNA sequence and analysis of the large virulence plasmid of Shigella flexneri." Venkatesan M.M., Goldberg M.B., Rose D.J., Grotbeck E.J., Burland V., Blattner F.R. Infect. Immun. 69:3271-3285 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain K12) CYSG Polyclonal Antibody
MBS7163843 Inquire

Rabbit anti-Escherichia coli (strain K12) CYSG Polyclonal Antibody

Sign In for Pricing
View Details
TRNAM13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV752953 1.0 µg DNA

TRNAM13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human Nogo Protein - (Dry Ice)
H00057142-P01-10ug 10 µg

Recombinant Human Nogo Protein - (Dry Ice)

Sign In for Pricing
View Details
Rabbit Polyclonal Ropporin 1-like Antibody [mFluor Violet 500 SE]
NBP2-99172MFV500 0.1 mL

Rabbit Polyclonal Ropporin 1-like Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
1- (tert-Butyl) -4,5-dimethyl-1H-pyrazol-3-amine
OR1006022 100 mg

1- (tert-Butyl) -4,5-dimethyl-1H-pyrazol-3-amine

Sign In for Pricing
View Details
PTP4A2 Rabbit Polyclonal Antibody
E53P12628 100 µL

PTP4A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details