Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

cDNA - Human Adult Normal Tissue: Brain: Cerebellum (right)
C1234041-10 10 Reactions

cDNA - Human Adult Normal Tissue: Brain: Cerebellum (right)

Sign In for Pricing
View Details
Anti-SCAND1 Rabbit pAb
GB112628-100 100 μL

Anti-SCAND1 Rabbit pAb

Sign In for Pricing
View Details
Kinesis Tubing FEP 1/16 od x 0.020 (0.5mm) id
CHR2293 50 FT

Kinesis Tubing FEP 1/16 od x 0.020 (0.5mm) id

Sign In for Pricing
View Details
GLUT3
317374 100 µL

GLUT3

Sign In for Pricing
View Details
beta Amyloid 1-42 Antibody HRP Conjugated
MBS9459756-01 0.1 mL

beta Amyloid 1-42 Antibody HRP Conjugated

Sign In for Pricing
View Details
beta Amyloid 1-42 Antibody HRP Conjugated
MBS9459756-02 5x 0.1 mL

beta Amyloid 1-42 Antibody HRP Conjugated

Sign In for Pricing
View Details