Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4993207 1.0 µg DNA

Usp12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Protein ATP1B4 (ATP1B4) Chicken ELISA Kit
G2439 96 Tests

Protein ATP1B4 (ATP1B4) Chicken ELISA Kit

Sign In for Pricing
View Details
Isoformononetin
C04641 1 mg

Isoformononetin

Sign In for Pricing
View Details
Human Uncharacterized protein CXorf59, CXorf59 ELISA KIT
ELI-32094h 96 Tests

Human Uncharacterized protein CXorf59, CXorf59 ELISA KIT

Sign In for Pricing
View Details
LOC690478 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV645073 1.0 µg DNA

LOC690478 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Biotin-Linked Anti-Inducible T-Cell Co Stimulator (ICOS)
FY-AB43255-01 1 mL

Biotin-Linked Anti-Inducible T-Cell Co Stimulator (ICOS)

Sign In for Pricing
View Details