Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEGF8 (NM_001410) Human 3' UTR Clone
SC217321 10 µg

MEGF8 (NM_001410) Human 3' UTR Clone

Sign In for Pricing
View Details
MAPK10 antibody
MBS5310893-01 0.1 mL

MAPK10 antibody

Sign In for Pricing
View Details
MAPK10 antibody
MBS5310893-02 5x 0.1 mL

MAPK10 antibody

Sign In for Pricing
View Details
ERGIC-2 CRISPR/Cas9 KO Plasmid (h)
sc-409934 20 µg

ERGIC-2 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
ZNF205 Rabbit Polyclonal Antibody
TA355616 100 µL

ZNF205 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RXFP3 Protein Vector (Human) (pPB-N-His)
PV057426 500 ng

RXFP3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details