Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGD5 Knockout 786O Polyclonal Cells
ARG5037 1 Million

FGD5 Knockout 786O Polyclonal Cells

Sign In for Pricing
View Details
Human Mesothelin (MSLN) ELISA Kit
MBS3800781-01 48 Well

Human Mesothelin (MSLN) ELISA Kit

Sign In for Pricing
View Details
Human Mesothelin (MSLN) ELISA Kit
MBS3800781-02 96 Well

Human Mesothelin (MSLN) ELISA Kit

Sign In for Pricing
View Details
Human Mesothelin (MSLN) ELISA Kit
MBS3800781-03 5x 96 Well

Human Mesothelin (MSLN) ELISA Kit

Sign In for Pricing
View Details
Human Mesothelin (MSLN) ELISA Kit
MBS3800781-04 10x 96 Well

Human Mesothelin (MSLN) ELISA Kit

Sign In for Pricing
View Details
Canine NOS ELISA Kit
ECN0099 96 Tests

Canine NOS ELISA Kit

Sign In for Pricing
View Details