Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TTLL12 Antibody (OTI7F11) [Alexa Fluor 350]
NBP2-74676AF350 0.1 mL

Mouse Monoclonal TTLL12 Antibody (OTI7F11) [Alexa Fluor 350]

Sign In for Pricing
View Details
Tetradecanenitrile
MF-0154144 25 mg

Tetradecanenitrile

Sign In for Pricing
View Details
Anti-human complement C4 Antibody
MBS418435-01 0.1 mg

Anti-human complement C4 Antibody

Sign In for Pricing
View Details
Anti-human complement C4 Antibody
MBS418435-02 5x 0.1 mg

Anti-human complement C4 Antibody

Sign In for Pricing
View Details
Goat Polyclonal ATM Antibody [Alexa Fluor 350]
NB100-271AF350 0.1 mL

Goat Polyclonal ATM Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
ARID4A antibody - C-terminal region
MBS3201318-01 0.1 mL

ARID4A antibody - C-terminal region

Sign In for Pricing
View Details