Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Plakophilin 2, PKP2 ELISA KIT
E0913Mo-01 48 Well

Mouse Plakophilin 2, PKP2 ELISA KIT

Sign In for Pricing
View Details
Mouse Plakophilin 2, PKP2 ELISA KIT
E0913Mo-02 96 Well

Mouse Plakophilin 2, PKP2 ELISA KIT

Sign In for Pricing
View Details
Mouse Plakophilin 2, PKP2 ELISA KIT
E0913Mo-03 5x 96 Tests

Mouse Plakophilin 2, PKP2 ELISA KIT

Sign In for Pricing
View Details
Mouse Plakophilin 2, PKP2 ELISA KIT
E0913Mo-04 10x 96 Tests

Mouse Plakophilin 2, PKP2 ELISA KIT

Sign In for Pricing
View Details
CYR61 (Protein CYR61, CCN Family Member 1, Cysteine-rich Angiogenic Inducer 61, Insulin-like Growth Factor-binding Protein 10, IBP-10, IGF-binding Protein 10, IGFBP-10, Protein GIG1, CCN1, GIG1, IGFBP10) discontinued. see C9018-01A
136885 100 µL

CYR61 (Protein CYR61, CCN Family Member 1, Cysteine-rich Angiogenic Inducer 61, Insulin-like Growth Factor-binding Protein 10, IBP-10, IGF-binding Protein 10, IGFBP-10, Protein GIG1, CCN1, GIG1, IGFBP10) discontinued. see C9018-01A

Sign In for Pricing
View Details
Human RASSF10 Protein Lysate
MBS8418335-01 0.02 mg

Human RASSF10 Protein Lysate

Sign In for Pricing
View Details