Fas Ligand, Human (His)
FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Fas Ligand Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html
Purity
98.00
Smiles
QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Molecular Formula
356 (Gene_ID) P48023-1 (Q103-L281) (Accession)
Molecular Weight
26 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0276904 1.0 µg DNA
C10orf62 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details ![Rabbit Polyclonal PSG1 Antibody [Alexa Fluor 594]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP2-97038AF594 0.1 mL
Rabbit Polyclonal PSG1 Antibody [Alexa Fluor 594]
Sign In for Pricing
View Details 350996 96 Tests
IFN-gamma (Interferon-gamma), BioAssayTM ELISA Kit (Mouse) discontinued
Sign In for Pricing
View Details 
A3327-ML650 100 µL
Arc p34 (ARP2/3 Complex 34kD subunit, Actin-related Protein 2/3 Complex subunit 2) (MaxLight 650) discontinued
Sign In for Pricing
View Details 