Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-M. hominis p120 Monoclonal Antibody, clone 7616
CABT-CS969 100 μg

Mouse Anti-M. hominis p120 Monoclonal Antibody, clone 7616

Sign In for Pricing
View Details
CLPS ORF Vector (Human) (pORF)
ORF002465 1.0 µg DNA

CLPS ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Olr1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4413507 1.0 µg DNA

Olr1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Anti-SerpinB8 antibody
SL19660R-01 50 µL

Rabbit Anti-SerpinB8 antibody

Sign In for Pricing
View Details
Rabbit Anti-SerpinB8 antibody
SL19660R-02 100 µL

Rabbit Anti-SerpinB8 antibody

Sign In for Pricing
View Details
TOMM40 (NM_001128917) Human Tagged Lenti ORF Clone
RC225543L3 10 µg

TOMM40 (NM_001128917) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details