Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Krt82 shRNA (UAS) - Lentiviral mouse Krt82 shRNA (UAS, GFP) plasmid
GTR15196954 1 Vial

Lentiviral mouse Krt82 shRNA (UAS) - Lentiviral mouse Krt82 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Wnt9a sgRNA CRISPR Lentivector (Rat) (Target 1)
K6713102 1.0 µg DNA

Wnt9a sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recombinant Human DSG3, C-His
MBS1576053-01 0.1 mg

Recombinant Human DSG3, C-His

Sign In for Pricing
View Details
Recombinant Human DSG3, C-His
MBS1576053-02 1 mg

Recombinant Human DSG3, C-His

Sign In for Pricing
View Details
Recombinant Human DSG3, C-His
MBS1576053-03 5x 1 mg

Recombinant Human DSG3, C-His

Sign In for Pricing
View Details
OR56A7P sgRNA CRISPR Lentivector (Human) (Target 2)
K1571403 1.0 µg DNA

OR56A7P sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details