Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBS7 Lentiviral Activation Particles (m)
sc-427963-LAC 200 µL

BBS7 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
L-Arginine hydrochloride
1119-34-2 1 Each

L-Arginine hydrochloride

Sign In for Pricing
View Details
Plant Caspase 14 (CASP14) ELISA Kit
MBS9374826 Inquire

Plant Caspase 14 (CASP14) ELISA Kit

Sign In for Pricing
View Details
Phospho-MAP4K4 (Ser629) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-5491R-BF647 100 µL

Phospho-MAP4K4 (Ser629) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Zfp46 sgRNA CRISPR Lentivector set (Rat)
K6328801 3x 1.0 µg

Zfp46 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
ELOVL1 Protein Vector (Mouse) (pPM-C-His)
PV175413 500 ng

ELOVL1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details