Fas Ligand, Human (His)
FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Fas Ligand Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html
Purity
98.00
Smiles
QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Molecular Formula
356 (Gene_ID) P48023-1 (Q103-L281) (Accession)
Molecular Weight
26 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
138467 100 µg
Tropomyosin, Human (Tropomyosin 1, TPM1, Tropomyosin 1 alpha, Tropomyosin 1 alpha Chain, Tropomyosin 1 alpha Chain Isoform 6, TPM1 alpha, TPM1 kappa, Tropomyosin 2, TPM2, Tropomyosin 2 beta, Tropomyosin 3, TPM3, Tropomyosin alpha 3 Chain, Tropomyosin alpha Striated Muscle Isoform, TMSA, Tropomyosin beta Chain, TMSB, Tropomyosin gamma, Alpha Tropomyosin, Arthrogryposis Multiplex Congenital Distal Type 1, AMCD1, Beta Tropomyosin, Cytoskeletal Tropomyosin TM30, DA1, FLJ41118, Heat Stable Cytoskeletal Protein 30kD, HSCP30, HTM alpha, hTM5, MGC14582, MGC3261, MGC72094, NEM1, OK/SW cl.5, Sarcomeric Tropomyosin kappa, TM 5, TM-5, TM3, TM30, TM30nm, TnH, TRK)
Sign In for Pricing
View Details 
MR204047L4V 200 µL
Endog (NM_007931) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
MBS651587-01 25 mg
Anisomycin (Flagecidin, Antibiotic SA 3097C1, Antibiotic PA 106, Anhydroscopin A, NSC)
Sign In for Pricing
View Details MBS651587-02 100 mg
Anisomycin (Flagecidin, Antibiotic SA 3097C1, Antibiotic PA 106, Anhydroscopin A, NSC)
Sign In for Pricing
View Details