Fas Ligand, Human (His)
FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Fas Ligand Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html
Purity
98.00
Smiles
QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Molecular Formula
356 (Gene_ID) P48023-1 (Q103-L281) (Accession)
Molecular Weight
26 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6128627-01 0.1 mL
Fatty Acid Binding Protein, Heart (Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid Binding Protein 3, FABP3, FABP11, Mammary-derived Growth Inhibitor, MDGI, Muscle Fatty Acid Binding Protein, M-FABP, O-FABP) (HRP)
Sign In for Pricing
View Details 
MBS6128627-02 5x 0.1 mL
Fatty Acid Binding Protein, Heart (Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid Binding Protein 3, FABP3, FABP11, Mammary-derived Growth Inhibitor, MDGI, Muscle Fatty Acid Binding Protein, M-FABP, O-FABP) (HRP)
Sign In for Pricing
View Details 
