Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Follicle Stimulating Hormone Beta (FSHb) Recombinant, Porcine
154673-01 10 µg

Follicle Stimulating Hormone Beta (FSHb) Recombinant, Porcine

Sign In for Pricing
View Details
Follicle Stimulating Hormone Beta (FSHb) Recombinant, Porcine
154673-02 50 µg

Follicle Stimulating Hormone Beta (FSHb) Recombinant, Porcine

Sign In for Pricing
View Details
Follicle Stimulating Hormone Beta (FSHb) Recombinant, Porcine
154673-03 200 µg

Follicle Stimulating Hormone Beta (FSHb) Recombinant, Porcine

Sign In for Pricing
View Details
Adam1b (NM_172125) Mouse Tagged Lenti ORF Clone
MR216210L3 10 µg

Adam1b (NM_172125) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NRP1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV690888 1.0 µg DNA

NRP1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
GTF2H2C, CT (GTF2H2C, General transcription factor IIH subunit 2-like protein, General transcription factor IIH polypeptide 2-like protein) (MaxLight 405) discontinued
036359-ML405 100 µL

GTF2H2C, CT (GTF2H2C, General transcription factor IIH subunit 2-like protein, General transcription factor IIH polypeptide 2-like protein) (MaxLight 405) discontinued

Sign In for Pricing
View Details