Fas Ligand, Human (His)
FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Fas Ligand Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html
Purity
98.00
Smiles
QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Molecular Formula
356 (Gene_ID) P48023-1 (Q103-L281) (Accession)
Molecular Weight
26 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7033998-01 0.02 mg
Recombinant Escherichia coli O9:H4 UPF0259 membrane protein yciC (yciC)
Sign In for Pricing
View Details 
MBS7033998-02 0.1 mg
Recombinant Escherichia coli O9:H4 UPF0259 membrane protein yciC (yciC)
Sign In for Pricing
View Details MBS7033998-03 5x 0.1 mg
Recombinant Escherichia coli O9:H4 UPF0259 membrane protein yciC (yciC)
Sign In for Pricing
View Details 
PH30418E1 50 µg
Upstream Binding Protein 1 (UBP1) (NM_014517) Human Recombinant Protein
Sign In for Pricing
View Details C7948-25V-ML650 100 µL
CTRP6, CT (C1q and Tumor Necrosis Factor Related Protein 6, C1qTNF6, PRO1151, UNQ581, ZACRP6) (MaxLight 650) discontinued
Sign In for Pricing
View Details RG-E140928-01 10 mg
1,4-bis (dodecyloxy) -1,4-dioxobutane-2-sulfonic acid
Sign In for Pricing
View Details