Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARD6B Protein Vector (Mouse) (pPB-N-His)
PV213531 500 ng

PARD6B Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Thrsp sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6791107 1.0 µg DNA

Thrsp sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
LEPRE1 (Leucine Proline-enriched Proteoglycan (leprecan) 1, GROS1, MGC117314, P3H1) (Biotin)
248127-Biotin 100 µL

LEPRE1 (Leucine Proline-enriched Proteoglycan (leprecan) 1, GROS1, MGC117314, P3H1) (Biotin)

Sign In for Pricing
View Details
Human Olfactory receptor 6S1, OR6S1 ELISA KIT
ELI-22497h 96 Tests

Human Olfactory receptor 6S1, OR6S1 ELISA KIT

Sign In for Pricing
View Details
Ppp6c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K5014908 1.0 µg DNA

Ppp6c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
MED18 3'UTR GFP Stable Cell Line
TU063189 1.0 mL

MED18 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details