Fas Ligand, Human (His)
FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Fas Ligand Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html
Purity
98.00
Smiles
QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Molecular Formula
356 (Gene_ID) P48023-1 (Q103-L281) (Accession)
Molecular Weight
26 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1175361-01 0.02 mg (E-Coli)
Recombinant Escherichia coli D-tagatose-1,6-bisphosphate aldolase subunit kbaZ (kbaZ)
Sign In for Pricing
View Details 
MBS1175361-02 0.02 mg (Yeast)
Recombinant Escherichia coli D-tagatose-1,6-bisphosphate aldolase subunit kbaZ (kbaZ)
Sign In for Pricing
View Details MBS1175361-03 0.1 mg (E-Coli)
Recombinant Escherichia coli D-tagatose-1,6-bisphosphate aldolase subunit kbaZ (kbaZ)
Sign In for Pricing
View Details MBS1175361-04 0.1 mg (Yeast)
Recombinant Escherichia coli D-tagatose-1,6-bisphosphate aldolase subunit kbaZ (kbaZ)
Sign In for Pricing
View Details 
MBS1175361-05 0.02 mg (Baculovirus)
Recombinant Escherichia coli D-tagatose-1,6-bisphosphate aldolase subunit kbaZ (kbaZ)
Sign In for Pricing
View Details 
MBS1175361-06 0.02 mg (Mammalian-Cell)
Recombinant Escherichia coli D-tagatose-1,6-bisphosphate aldolase subunit kbaZ (kbaZ)
Sign In for Pricing
View Details