Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAS1L Antibody, Biotin conjugated

A72406-100UG 100 µg

LAS1L Antibody, Biotin conjugated

Sign In for Pricing

RNF149 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI12C2]

TA810551BM 100 µL

RNF149 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI12C2]

Sign In for Pricing

Human CPEB3 activation kit by CRISPRa

GA107852 1 Kit

Human CPEB3 activation kit by CRISPRa

Sign In for Pricing

TBC1D4 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

bs-5893R-BF350 100 µL

TBC1D4 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing

Dyrk1b sgRNA CRISPR Lentivector (Rat) (Target 1)

K6437602 1.0 µg DNA

Dyrk1b sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing

ZNF90P3 Recombinant Protein (Human)

RP109421 100 µg

ZNF90P3 Recombinant Protein (Human)

Sign In for Pricing