Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANO7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0095607 1.0 µg DNA

ANO7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human Sphingosine 1 Phosphate (S1P) ELISA Kit
SL3205Hu-01 96 Tests

Human Sphingosine 1 Phosphate (S1P) ELISA Kit

Sign In for Pricing
View Details
Human Sphingosine 1 Phosphate (S1P) ELISA Kit
SL3205Hu-02 48 Tests

Human Sphingosine 1 Phosphate (S1P) ELISA Kit

Sign In for Pricing
View Details
Olr551 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV635601 1.0 µg DNA

Olr551 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
PSEN2 Protein Vector (Mouse) (pPB-N-His)
PV220247 500 ng

PSEN2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Antirrhinum majus Translation initiation factor IF-1, chloroplastic (infA)
MBS1086275-01 0.02 mg (E-Coli)

Recombinant Antirrhinum majus Translation initiation factor IF-1, chloroplastic (infA)

Sign In for Pricing
View Details