Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mat2b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7493306 1.0 µg DNA

Mat2b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
N Recombinant Antibody
RAC07046-01 50 µL

N Recombinant Antibody

Sign In for Pricing
View Details
N Recombinant Antibody
RAC07046-02 100 µL

N Recombinant Antibody

Sign In for Pricing
View Details
RO495 5mg
A22328-5 5 mg

RO495 5mg

Sign In for Pricing
View Details
Monoamine Oxidase A Blocking Peptide
abx064171-01 1 mg

Monoamine Oxidase A Blocking Peptide

Sign In for Pricing
View Details
Monoamine Oxidase A Blocking Peptide
abx064171-02 5 mg

Monoamine Oxidase A Blocking Peptide

Sign In for Pricing
View Details