Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Human CD197/CCR7 Antibody
MBS4516410-01 20 Tests

PE/Cyanine7 Anti-Human CD197/CCR7 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD197/CCR7 Antibody
MBS4516410-02 50 Tests

PE/Cyanine7 Anti-Human CD197/CCR7 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD197/CCR7 Antibody
MBS4516410-03 100 Tests

PE/Cyanine7 Anti-Human CD197/CCR7 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD197/CCR7 Antibody
MBS4516410-04 200 Tests

PE/Cyanine7 Anti-Human CD197/CCR7 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD197/CCR7 Antibody
MBS4516410-05 5x 200 Tests

PE/Cyanine7 Anti-Human CD197/CCR7 Antibody

Sign In for Pricing
View Details
Mouse Glutathione Peroxidase 3, Plasma ELISA Kit (GPX3)
RK02862 96 Tests

Mouse Glutathione Peroxidase 3, Plasma ELISA Kit (GPX3)

Sign In for Pricing
View Details