Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GABA (A) R, Alpha1 Antibody (N95/43)
RHD07302 100 μg

Anti-GABA (A) R, Alpha1 Antibody (N95/43)

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM34 Antibody [Biotin]
NBP1-77144B 0.1 mL

Rabbit Polyclonal TMEM34 Antibody [Biotin]

Sign In for Pricing
View Details
GSTK1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV672114 1.0 µg DNA

GSTK1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
SSH3 (Protein Phosphatase Slingshot Homolog 3, SSH-like Protein 3, SSH3L, SSH-3L, hSSH-3L) (MaxLight 650)
133864-ML650 100 µL

SSH3 (Protein Phosphatase Slingshot Homolog 3, SSH-like Protein 3, SSH3L, SSH-3L, hSSH-3L) (MaxLight 650)

Sign In for Pricing
View Details
EPI-001
C18075 200 mg

EPI-001

Sign In for Pricing
View Details
CNIH2, NT (CNIH2, CNIL, Protein cornichon homolog 2, Cornichon-like protein) (Azide free) (HRP) discontinued
034042-HRP 200 µL

CNIH2, NT (CNIH2, CNIL, Protein cornichon homolog 2, Cornichon-like protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details