Fas Ligand, Human (His)
FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Fas Ligand Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html
Purity
98.00
Smiles
QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Molecular Formula
356 (Gene_ID) P48023-1 (Q103-L281) (Accession)
Molecular Weight
26 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Lsx2473-1mgEcoli 1 mg (E. coli)
Recombinant Borrelia Turicatae ldh Protein (aa 1-316)
Sign In for Pricing
View Details ![Mouse Monoclonal Numb Antibody (OTI4F3) [Dylight 594]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP2-73129DL594 0.1 mL
Mouse Monoclonal Numb Antibody (OTI4F3) [Dylight 594]
Sign In for Pricing
View Details 
GTR15171400 1 Vial
Lentiviral mouse Hsp90b1 shRNA (UAS) - Lentiviral mouse Hsp90b1 shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details VAng-Lsx03047-inquire Inquire
Recombinant Escherichia coli zupT Protein (aa 1-257) (strain ED1a)
Sign In for Pricing
View Details