Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DR1 (NM_001938) Human Recombinant Protein
TP305733L 1 mg

DR1 (NM_001938) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal MKK4/MEK4 Antibody [DyLight 550]
NBP2-99331R 0.1 mL

Rabbit Polyclonal MKK4/MEK4 Antibody [DyLight 550]

Sign In for Pricing
View Details
anti-UBE2C (9D3)
LF-MA10360 100 ug

anti-UBE2C (9D3)

Sign In for Pricing
View Details
Rabbit Polyclonal AZI2 Antibody [Alexa Fluor 405]
NBP2-97191AF405 0.1 mL

Rabbit Polyclonal AZI2 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
UGT2B10 (NM_001075) Human Over-expression Lysate
LH04930V 100 µg

UGT2B10 (NM_001075) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human DEPTOR Protein, GST-tagged
DEPTOR-5182H 2 µg

Recombinant Human DEPTOR Protein, GST-tagged

Sign In for Pricing
View Details