Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IGSF3 protein, His-tagged
IGSF3-6960H 20 µg

Recombinant Human IGSF3 protein, His-tagged

Sign In for Pricing
View Details
MUC1 (PUM, Mucin-1, H23AG, PEMT, CD227, Mucin-1 subunit alpha, MAM6, MUC-1/SEC, MUC-1)
136264 250 µL

MUC1 (PUM, Mucin-1, H23AG, PEMT, CD227, Mucin-1 subunit alpha, MAM6, MUC-1/SEC, MUC-1)

Sign In for Pricing
View Details
Human Fucosyltransferase 7/FUT7 Recombinant Protein
PROTQ11130-4ug 4 µg

Human Fucosyltransferase 7/FUT7 Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Blocks, Liver
CB619231 1 Block

Frozen Tissue Blocks, Liver

Sign In for Pricing
View Details
Pla2g10 sgRNA CRISPR Lentivector set (Mouse)
K4415101 3x 1.0 µg

Pla2g10 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Hamster leukocyte endothelial cell adhesion molecule 2 selectin E, SELE GENLISA ELISA
KLH0044 96 Well

Hamster leukocyte endothelial cell adhesion molecule 2 selectin E, SELE GENLISA ELISA

Sign In for Pricing
View Details