Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPANXB2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2265608 1.0 µg DNA

SPANXB2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human UBE2D2 AssayLite™ Antibody (APC Conjugate)
33271-05161 5x 30 µg

Human UBE2D2 AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details
JTB Antibody
ABD8670 100 µg

JTB Antibody

Sign In for Pricing
View Details
Anti-PLS1 Antibody Picoband
MBS1758845-01 0.01 mg

Anti-PLS1 Antibody Picoband

Sign In for Pricing
View Details
Anti-PLS1 Antibody Picoband
MBS1758845-02 0.1 mg (Carrier Free)

Anti-PLS1 Antibody Picoband

Sign In for Pricing
View Details
Anti-PLS1 Antibody Picoband
MBS1758845-03 0.1 mg

Anti-PLS1 Antibody Picoband

Sign In for Pricing
View Details