Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSCAN5B Rabbit Polyclonal Antibody (C-term)
E28PB4305 100 µL

ZSCAN5B Rabbit Polyclonal Antibody (C-term)

Sign In for Pricing
View Details
Heat Shock 70 kDa Protein 6 (HSPA6) Antibody (FITC)
abx106912-01 20 µg

Heat Shock 70 kDa Protein 6 (HSPA6) Antibody (FITC)

Sign In for Pricing
View Details
Heat Shock 70 kDa Protein 6 (HSPA6) Antibody (FITC)
abx106912-02 50 µg

Heat Shock 70 kDa Protein 6 (HSPA6) Antibody (FITC)

Sign In for Pricing
View Details
Heat Shock 70 kDa Protein 6 (HSPA6) Antibody (FITC)
abx106912-03 100 µg

Heat Shock 70 kDa Protein 6 (HSPA6) Antibody (FITC)

Sign In for Pricing
View Details
Heat Shock 70 kDa Protein 6 (HSPA6) Antibody (FITC)
abx106912-04 200 µg

Heat Shock 70 kDa Protein 6 (HSPA6) Antibody (FITC)

Sign In for Pricing
View Details
Heat Shock 70 kDa Protein 6 (HSPA6) Antibody (FITC)
abx106912-05 1 mg

Heat Shock 70 kDa Protein 6 (HSPA6) Antibody (FITC)

Sign In for Pricing
View Details