Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TCR αβ/alpha-beta TCR Antibody , FITC
E55A07858 50 Tests

Mouse TCR αβ/alpha-beta TCR Antibody , FITC

Sign In for Pricing
View Details
AR-C133913XX
TRC-A766550-25MG 25 mg

AR-C133913XX

Sign In for Pricing
View Details
Recombinant Human DTYMK, His-tagged
DTYMK-12195H 25 µg

Recombinant Human DTYMK, His-tagged

Sign In for Pricing
View Details
Recombinant Shigella sonnei Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)
MBS1397671-01 0.02 mg (E-Coli)

Recombinant Shigella sonnei Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)

Sign In for Pricing
View Details
Recombinant Shigella sonnei Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)
MBS1397671-02 0.02 mg (Yeast)

Recombinant Shigella sonnei Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)

Sign In for Pricing
View Details
Recombinant Shigella sonnei Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)
MBS1397671-03 0.1 mg (E-Coli)

Recombinant Shigella sonnei Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)

Sign In for Pricing
View Details