Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC382044 shRNA Plasmid (m)
sc-148655-SH 20 µg

LOC382044 shRNA Plasmid (m)

Sign In for Pricing
View Details
Floridanine
HY-N8645 1 Each

Floridanine

Sign In for Pricing
View Details
TFG antibody
70R-20788 50 ul

TFG antibody

Sign In for Pricing
View Details
LIPH Protein Vector (Mouse) (pPM-C-HA)
PV196812 500 ng

LIPH Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-Human MYOM3/Myomesin-3 Monoclonal Antibody (1A132)
HP488025-01 50 µg

Anti-Human MYOM3/Myomesin-3 Monoclonal Antibody (1A132)

Sign In for Pricing
View Details
Anti-Human MYOM3/Myomesin-3 Monoclonal Antibody (1A132)
HP488025-02 100 µg

Anti-Human MYOM3/Myomesin-3 Monoclonal Antibody (1A132)

Sign In for Pricing
View Details