Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal EpCAM/TROP1 Antibody (323/A3) [mFluor Violet 450 SE]
NBP2-34532MFV450 0.1 mL

Mouse Monoclonal EpCAM/TROP1 Antibody (323/A3) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
TBL1Y (NM_134259) Human Tagged ORF Clone Lentiviral Particle
RC212240L4V 200 µL

TBL1Y (NM_134259) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HumanANG2 (Angiopoietin2) ELISAKit
ELK1402-01 48 Tests

HumanANG2 (Angiopoietin2) ELISAKit

Sign In for Pricing
View Details
HumanANG2 (Angiopoietin2) ELISAKit
ELK1402-02 96 Tests

HumanANG2 (Angiopoietin2) ELISAKit

Sign In for Pricing
View Details
Anti-MYO1H Antibody (aa1002-1014)
MBS2400887-01 0.05 mg

Anti-MYO1H Antibody (aa1002-1014)

Sign In for Pricing
View Details
Anti-MYO1H Antibody (aa1002-1014)
MBS2400887-02 5x 0.0 5mg

Anti-MYO1H Antibody (aa1002-1014)

Sign In for Pricing
View Details