Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCSF Recombinant Antibody, FITC Conjugated
bsm-61014R-FITC 100 µL

MCSF Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
Lentiviral human AGTPBP1 shRNA (UAS) - Lentiviral human AGTPBP1 shRNA (UAS) (100)
GTR15082134 1 Vial

Lentiviral human AGTPBP1 shRNA (UAS) - Lentiviral human AGTPBP1 shRNA (UAS) (100)

Sign In for Pricing
View Details
DiagNano™ CdSe/ZnS Quantum Dots, 580 nm
DNK-B014 25 mg

DiagNano™ CdSe/ZnS Quantum Dots, 580 nm

Sign In for Pricing
View Details
RBL1 (RB-like 1, Retinoblastoma-like Protein 1, 107kD Retinoblastoma-associated Protein, PRB1, P107, MGC40006) (APC)
132383-APC 100 µL

RBL1 (RB-like 1, Retinoblastoma-like Protein 1, 107kD Retinoblastoma-associated Protein, PRB1, P107, MGC40006) (APC)

Sign In for Pricing
View Details
ZNF70 polyclonal antibody
BS72831-01 50 µL

ZNF70 polyclonal antibody

Sign In for Pricing
View Details
ZNF70 polyclonal antibody
BS72831-02 100 µL

ZNF70 polyclonal antibody

Sign In for Pricing
View Details