Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal PLSCR1 Antibody (monoclonal) (M01), Clone: 1F9
APR11166G 0.1mg

Monoclonal PLSCR1 Antibody (monoclonal) (M01), Clone: 1F9

Sign In for Pricing
View Details
Flcn (NM_146018) Mouse Tagged Lenti ORF Clone
MR209086L3 10 µg

Flcn (NM_146018) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LYSMD1 Antibody
KC-3721-01 50 μL

LYSMD1 Antibody

Sign In for Pricing
View Details
LYSMD1 Antibody
KC-3721-02 100 µL

LYSMD1 Antibody

Sign In for Pricing
View Details
LYSMD1 Antibody
KC-3721-03 1 mL

LYSMD1 Antibody

Sign In for Pricing
View Details
Anti-HBV HBcAg Monoclonal Antibody (1A243)
MVV11501 100 μg

Anti-HBV HBcAg Monoclonal Antibody (1A243)

Sign In for Pricing
View Details