Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MeCP2 Rabbit Polyclonal Antibody
MBS9518109-01 0.05 mL

MeCP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MeCP2 Rabbit Polyclonal Antibody
MBS9518109-02 0.1 mL

MeCP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MeCP2 Rabbit Polyclonal Antibody
MBS9518109-03 5x 0.1 mL

MeCP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SCLY Antibody
NBP2-97263-50ul 50 µL

Rabbit Polyclonal SCLY Antibody

Sign In for Pricing
View Details
SCZD2 sgRNA CRISPR Lentivector set (Human)
K2106301 3x 1.0 µg

SCZD2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Nuclear RNA Export Factor 1 (NXF1) Polyclonal Antibody
MBS2032895-01 0.1 mL

Nuclear RNA Export Factor 1 (NXF1) Polyclonal Antibody

Sign In for Pricing
View Details