Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Artery Membrane Tissue Lysate (Adult Membrane Normal) - (Dry Ice)
NB820-60569 0.1 mg

Human Artery Membrane Tissue Lysate (Adult Membrane Normal) - (Dry Ice)

Sign In for Pricing
View Details
ANAPC2 antibody
MBS532814-01 0.1 mL

ANAPC2 antibody

Sign In for Pricing
View Details
ANAPC2 antibody
MBS532814-02 5x 0.1 mL

ANAPC2 antibody

Sign In for Pricing
View Details
Anti-RNF125 / TRAC-1 Antibody (aa131-180) IHC-plus
MBS2400001-01 0.05 mL

Anti-RNF125 / TRAC-1 Antibody (aa131-180) IHC-plus

Sign In for Pricing
View Details
Anti-RNF125 / TRAC-1 Antibody (aa131-180) IHC-plus
MBS2400001-02 5x 0.05 mL

Anti-RNF125 / TRAC-1 Antibody (aa131-180) IHC-plus

Sign In for Pricing
View Details
Recombinant Human FOLR1 CF
5646-FR-050 50 µg

Recombinant Human FOLR1 CF

Sign In for Pricing
View Details