Fas Ligand, Human (His)
FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Fas Ligand Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html
Purity
98.00
Smiles
QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Molecular Formula
356 (Gene_ID) P48023-1 (Q103-L281) (Accession)
Molecular Weight
26 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
040764-HRP 200 µL
RAB3B, CT (RAB3B, Ras-related protein Rab-3B) (Azide free) (HRP) discontinued
Sign In for Pricing
View Details 374811-01 20 µg
PPC, Recombinant, E. coli, aa5-883, His-Tag (Phosphoenolpyruvate Carboxylase)
Sign In for Pricing
View Details 
374811-02 100 µg
PPC, Recombinant, E. coli, aa5-883, His-Tag (Phosphoenolpyruvate Carboxylase)
Sign In for Pricing
View Details GTR15082286 1 Vial
Lentiviral human SMIM15 shRNA (UAS) - Lentiviral human SMIM15 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details