Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDR/FLT4 Antibody

A23540-50UG 50 µg

KDR/FLT4 Antibody

Sign In for Pricing

Rat Heat Shock Protein 40 (HSP40) ELISA Kit

YP-W35865-01 48 Tests

Rat Heat Shock Protein 40 (HSP40) ELISA Kit

Sign In for Pricing

Rat Heat Shock Protein 40 (HSP40) ELISA Kit

YP-W35865-02 96 Tests

Rat Heat Shock Protein 40 (HSP40) ELISA Kit

Sign In for Pricing

pBluescriptR-SLCO1A2 Plasmid

PVT23166 2 µg

pBluescriptR-SLCO1A2 Plasmid

Sign In for Pricing

Rabbit Polyclonal SLC1A7 Antibody [DyLight 755]

NBP2-81802IR 0.1 mL

Rabbit Polyclonal SLC1A7 Antibody [DyLight 755]

Sign In for Pricing

C9orf6 Protein Vector (Human) (pPB-C-His)

PV007025 500 ng

C9orf6 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing