Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Excision Repair Protein ERCC-1 (ERCC1) Antibody
abx232832 100 µg

DNA Excision Repair Protein ERCC-1 (ERCC1) Antibody

Sign In for Pricing
View Details
Odf3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4067605 3x 1.0 µg

Odf3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal CLCA1 Antibody [Alexa Fluor 647]
NBP2-99573AF647 0.1 mL

Rabbit Polyclonal CLCA1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
InVivoMAb Anti-MERS-CoV S1 N-terminal domain/S1-NTD Antibody (G2)
VK800020-01 50 µg

InVivoMAb Anti-MERS-CoV S1 N-terminal domain/S1-NTD Antibody (G2)

Sign In for Pricing
View Details
InVivoMAb Anti-MERS-CoV S1 N-terminal domain/S1-NTD Antibody (G2)
VK800020-02 100 µg

InVivoMAb Anti-MERS-CoV S1 N-terminal domain/S1-NTD Antibody (G2)

Sign In for Pricing
View Details
InVivoMAb Anti-MERS-CoV S1 N-terminal domain/S1-NTD Antibody (G2)
VK800020-03 1 mg

InVivoMAb Anti-MERS-CoV S1 N-terminal domain/S1-NTD Antibody (G2)

Sign In for Pricing
View Details