Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retnla Mouse shRNA Plasmid (Locus ID 57262)
TL503295 1 Kit

Retnla Mouse shRNA Plasmid (Locus ID 57262)

Sign In for Pricing
View Details
Human IL1R1 mRNA
HY-174626 500 µg

Human IL1R1 mRNA

Sign In for Pricing
View Details
FAM102B Protein Vector (Human) (pPB-N-His)
PV051810 500 ng

FAM102B Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Anti-Siltuximab ELISA Kit
AY328018 96 Tests

Anti-Siltuximab ELISA Kit

Sign In for Pricing
View Details
Recombinant HIV-1 gag p17 Protein, GST, E.coli-500ug
QP12242-500ug 500ug

Recombinant HIV-1 gag p17 Protein, GST, E.coli-500ug

Sign In for Pricing
View Details
Rabbit Polyclonal LPCAT3 Antibody
NBP3-10074-100ul 100 µL

Rabbit Polyclonal LPCAT3 Antibody

Sign In for Pricing
View Details