Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human RELT (RELT TNF receptor) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, PaRoom Temperatureial (26-153aa)
MPX4436K Each

Magic™ Membrane Protein Human RELT (RELT TNF receptor) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, PaRoom Temperatureial (26-153aa)

Sign In for Pricing
View Details
NF2 Antibody
KC-3517-01 50 μL

NF2 Antibody

Sign In for Pricing
View Details
NF2 Antibody
KC-3517-02 100 µL

NF2 Antibody

Sign In for Pricing
View Details
NF2 Antibody
KC-3517-03 1 mL

NF2 Antibody

Sign In for Pricing
View Details
PAR4 Polyclonal Antibody, PerCP Conjugated
bs-9511R-PerCP 100 µL

PAR4 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Human RAB14 shRNA Plasmid
abx959827-01 150 µg

Human RAB14 shRNA Plasmid

Sign In for Pricing
View Details