Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog Thyroxine (T4) ELISA Kit
JL10448-01 48 Tests

Dog Thyroxine (T4) ELISA Kit

Sign In for Pricing
View Details
Dog Thyroxine (T4) ELISA Kit
JL10448-02 96 Tests

Dog Thyroxine (T4) ELISA Kit

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)
MBS7020548-01 0.02 mg

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)
MBS7020548-02 0.1 mg

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)
MBS7020548-03 5x 0.1 mg

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

Sign In for Pricing
View Details
Lentiviral human OR5L2 sgRNA gene knockout kit - Lentiviral human OR5L2 sgRNA gene knockout kit (plasmid)
GTR15355915 1 Vial

Lentiviral human OR5L2 sgRNA gene knockout kit - Lentiviral human OR5L2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details