Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK11A antibody (biotin)
MBS839531-01 0.1 mg

CDK11A antibody (biotin)

Sign In for Pricing
View Details
CDK11A antibody (biotin)
MBS839531-02 5x 0.1 mg

CDK11A antibody (biotin)

Sign In for Pricing
View Details
HS3ST1 Knockout CAL27 Polyclonal Cells
ARG35866 1 Million

HS3ST1 Knockout CAL27 Polyclonal Cells

Sign In for Pricing
View Details
HSF2BP Protein Vector (Mouse) (pPM-C-HA)
PV190080 500 ng

HSF2BP Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Benzoyl Ecgonine
TRC-B208125-250MG 250 mg

Benzoyl Ecgonine

Sign In for Pricing
View Details
TRBV21OR9-2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2455306 1.0 µg DNA

TRBV21OR9-2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details