Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

INO80C (NM_194281) Human Tagged Lenti ORF Clone
RC207408L1 10 µg

INO80C (NM_194281) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RAB5A-Specific antibody
FNab07039 100 µg

RAB5A-Specific antibody

Sign In for Pricing
View Details
Easypro Rat Acid Sphingomyelinase (ASM) ELISA Kit
FY-ER1289S 96 Well

Easypro Rat Acid Sphingomyelinase (ASM) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Tent2 shRNA (UAS) - Lentiviral mouse Tent2 shRNA (UAS, RFP) (100)
GTR15171876 1 Vial

Lentiviral mouse Tent2 shRNA (UAS) - Lentiviral mouse Tent2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
TOMM34 Protein Lysate (Mouse) with C-HA Tag
47292034 100 µg

TOMM34 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
BioFastspin Water Genomic DNA Purification Kit
TRI-C38S1 50T

BioFastspin Water Genomic DNA Purification Kit

Sign In for Pricing
View Details