Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant BTV 10 Outer Capsid Protein VP5 (aa 1-526)
VAng-Lsx04638-inquire Inquire

Recombinant BTV 10 Outer Capsid Protein VP5 (aa 1-526)

Sign In for Pricing
View Details
Mouse SRSF12 siRNA
abx935208-01 15 nmol

Mouse SRSF12 siRNA

Sign In for Pricing
View Details
Mouse SRSF12 siRNA
abx935208-02 30 nmol

Mouse SRSF12 siRNA

Sign In for Pricing
View Details
Sema4g Mouse siRNA Oligo Duplex (Locus ID 26456)
SR420561 1 Kit

Sema4g Mouse siRNA Oligo Duplex (Locus ID 26456)

Sign In for Pricing
View Details
Recombinant Shigella Flexneri ygfZ Protein (aa 2-326)
VAng-Lsx08397-500gEcoli 500 µg (E. coli)

Recombinant Shigella Flexneri ygfZ Protein (aa 2-326)

Sign In for Pricing
View Details
Mouse Mitotic checkpoint protein BUB3 (BUB3) ELISA Kit
abx504187 96 Tests

Mouse Mitotic checkpoint protein BUB3 (BUB3) ELISA Kit

Sign In for Pricing
View Details