Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Med19 sgRNA CRISPR Lentivector set (Mouse)
K4504701 3x 1.0 µg

Med19 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal NCAM-1/CD56 Antibody (301040) [DyLight 755]
FAB2408Z 0.5 mL

Mouse Monoclonal NCAM-1/CD56 Antibody (301040) [DyLight 755]

Sign In for Pricing
View Details
GOT2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62369R-BF488 100 µL

GOT2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Anti-Phospho-RB1 (Ser612) Polyclonal Antibody
MF-0086621-01 50 µL

Anti-Phospho-RB1 (Ser612) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-RB1 (Ser612) Polyclonal Antibody
MF-0086621-02 100 µL

Anti-Phospho-RB1 (Ser612) Polyclonal Antibody

Sign In for Pricing
View Details
TLN1 (Talin 1, ILWEQ, KIAA1027, TLN) (AP) discontinued
252718-AP 100 µL

TLN1 (Talin 1, ILWEQ, KIAA1027, TLN) (AP) discontinued

Sign In for Pricing
View Details