Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas Ligand, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fas Ligand Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/faslg-protein-human-his.html

Purity

98.00

Smiles

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Formula

356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

Molecular Weight

26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX3 (NM_005996) Human Over-expression Lysate
LS006926-100ug 100 µg

TBX3 (NM_005996) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal DBPA Antibody [PerCP]
NBP1-71827PCP 0.1 mL

Rabbit Polyclonal DBPA Antibody [PerCP]

Sign In for Pricing
View Details
Goat anti Rabbit IgG (Fc specific), conjugated with Biotin
GAR/IgG(Fc)/Bio 1 mL

Goat anti Rabbit IgG (Fc specific), conjugated with Biotin

Sign In for Pricing
View Details
Human SH2D1A qPCR Primer Pair
QH04077S 200 Tests

Human SH2D1A qPCR Primer Pair

Sign In for Pricing
View Details
Glucose BSA Colloidal Gold Conjugate, 1mL 40nm
CCG-0002-40 1 mL

Glucose BSA Colloidal Gold Conjugate, 1mL 40nm

Sign In for Pricing
View Details
Human CHDH qPCR Primer Pair
QH44897S 200 Tests

Human CHDH qPCR Primer Pair

Sign In for Pricing
View Details