Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELF3 (E74-like Factor 3 (ets Domain Transcription Factor, Epithelial-Specific), EPR-1, ERT, ESE-1, ESX) (FITC)

Product Specifications

Gene Name

[ELF3]

Storage Conditions

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.<br><br>FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Specificity

Recognizes ELF3.

Short Name

[ELF3]

Other Product Names

[ELF3 protein]

NCBI GI Number

13097735

NCBI Accession Number

AAH03569

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Itopride Pab
165626 100 µg

Anti Itopride Pab

Sign In for Pricing
View Details
MRPS25 (NM_022497) Human Recombinant Protein
TP301353 20 µg

MRPS25 (NM_022497) Human Recombinant Protein

Sign In for Pricing
View Details
NARG2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-5968R-BF405 100 µL

NARG2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Zfp593 sgRNA CRISPR Lentivector set (Rat)
K7584101 3x 1.0 µg

Zfp593 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
INTS8 (NM_017864) Human Tagged ORF Clone Lentiviral Particle
RC216855L4V 200 µL

INTS8 (NM_017864) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MBS5818163 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details