Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. CXCL16 Protein, Mouse (His) is the recombinant mouse-derived CXCL16 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl16-protein-mouse-his.html

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGAST

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-T198) (Accession)

Molecular Weight

22.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATA20 Polyclonal Antibody
E-AB-16072-01 20 µL

SPATA20 Polyclonal Antibody

Sign In for Pricing
View Details
SPATA20 Polyclonal Antibody
E-AB-16072-02 60 µL

SPATA20 Polyclonal Antibody

Sign In for Pricing
View Details
SPATA20 Polyclonal Antibody
E-AB-16072-03 120 µL

SPATA20 Polyclonal Antibody

Sign In for Pricing
View Details
SPATA20 Polyclonal Antibody
E-AB-16072-04 200 µL

SPATA20 Polyclonal Antibody

Sign In for Pricing
View Details
N-Nitroso-D,L-proline-d3
TRC-N545452-1MG 1 mg

N-Nitroso-D,L-proline-d3

Sign In for Pricing
View Details
Chlorophene
TRC-C375000-25G 25 g

Chlorophene

Sign In for Pricing
View Details