Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD42c/GP1BB, Human (HEK293, His)

CD42c/GP1BB protein, present on platelets, interacts with von Willebrand factor to form platelet plugs. It forms a heterodimer with GP1B beta subunits and associates with GP-IX, facilitating platelet adhesion and initiating thrombus formation. CD42c also interacts with TRAF4, potentially regulating cellular signaling pathways. CD42c/GP1BB Protein, Human (HEK293, His) is the recombinant human-derived CD42c/GP1BB protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD42c/GP1BB Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd42c-gp1bb-protein-human-hek293-his.html

Purity

99.00

Smiles

MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC

Molecular Formula

2812 (Gene_ID) P13224-1/NP_000398.1 (P27-C147) (Accession)

Molecular Weight

Approximately 20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1506 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4196704 1.0 µg DNA

Olfr1506 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
FAM84B Colorimetric Cell-Based ELISA
EKC1902 1 Kit, containing one 96 Well Plate and all necessary reagents

FAM84B Colorimetric Cell-Based ELISA

Sign In for Pricing
View Details
TXNIP AAV Vector (Mouse) (CMV)
48879105 1 µg

TXNIP AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
PGM2L1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G6]
TA812136AM 100 µL

PGM2L1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G6]

Sign In for Pricing
View Details
Anti-EAAT1/SLC1A3 Picoband® Antibody, Dylight594 Conjugate
A02133-Dylight594 100 µg

Anti-EAAT1/SLC1A3 Picoband® Antibody, Dylight594 Conjugate

Sign In for Pricing
View Details
Canine anti-endomysium IgA antibody ELISA kit
GTR10434242 96 Well

Canine anti-endomysium IgA antibody ELISA kit

Sign In for Pricing
View Details