PF-4/CXCL4, Human (HEK293, His)

PF-4/CXCL4 is a member of the CXC chemokine family that is released from the alpha-granules of activated platelets. PF-4/CXCL4 binds with high affinity to heparin, with antiheparin, antiangiogenic and immunomodulatory activities. PF-4/CXCL4 plays a role in hematopoiesis and immune cell modulation[1][2]. PF-4/CXCL4 Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 70 amino acids (E32-S101) .

Product Specifications

Product Name Alternative

PF-4/CXCL4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pf-4-cxcl4-protein-human-hek-293-his.html

Purity

98.00

Smiles

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Molecular Formula

5196 (Gene_ID) P02776 (E32-S101) (Accession)

Molecular Weight

Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Lasagni L, et al. PF-4/CXCL4 and CXCL4L1 exhibit distinct subcellular localization and a differentially regulated mechanism of secretion. Blood. 2007 May 15;109 (10) :4127-34.|[2]Pieter Ruytinx, et al. CXCL4 and CXCL4L1 in cancer. Cytokine. 2018 Sep;109:65-71.|[3]Gabriele Domschke, et al. CXCL4-induced macrophages in human atherosclerosis. Cytokine. 2019 Oct;122:154141.|[4]Alsya J Affandi, et al. CXCL4 is a novel inducer of human Th17 cells and correlates with IL-17 and IL-22 in psoriatic arthritis. Eur J Immunol. 2018 Mar;48 (3) :522-531.|[5]Jo Vandercappellen, et al. The role of the CXC chemokines platelet factor-4 (CXCL4/PF-4) and its variant (CXCL4L1/PF-4var) in inflammation, angiogenesis and cancer. Cytokine Growth Factor Rev. 2011 Feb;22 (1) :1-18.