Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3B Plasmid
PVT7113 2 µg

GSK3B Plasmid

Sign In for Pricing
View Details
Cardiotin (SR-2)
sc-53002 200 µg/mL

Cardiotin (SR-2)

Sign In for Pricing
View Details
Recombinant Shigella Flexneri yidA Protein (aa 1-270)
VAng-Lsx08425-500gEcoli 500 µg (E. coli)

Recombinant Shigella Flexneri yidA Protein (aa 1-270)

Sign In for Pricing
View Details
RNF166 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1840007 1.0 µg DNA

RNF166 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Marrowpan, Complete Medium for Bone Marrow Cells
P04-70250 500 mL

Marrowpan, Complete Medium for Bone Marrow Cells

Sign In for Pricing
View Details
Taxusin
HY-167728 1 Each

Taxusin

Sign In for Pricing
View Details