Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse RASGRF2 shRNA Plasmid
abx972391-01 150 µg

Mouse RASGRF2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse RASGRF2 shRNA Plasmid
abx972391-02 300 µg

Mouse RASGRF2 shRNA Plasmid

Sign In for Pricing
View Details
Cacna2d1 ORF Vector (Mouse) (pORF)
ORF040217 1.0 µg DNA

Cacna2d1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CEP57L1 Antibody
E51A06427 100 µL

CEP57L1 Antibody

Sign In for Pricing
View Details
Pyruvate Dehydrogenase Phosphatase 2 (PDP2), Recombinant, Human, His-Tag
049992-01 10 µg

Pyruvate Dehydrogenase Phosphatase 2 (PDP2), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Pyruvate Dehydrogenase Phosphatase 2 (PDP2), Recombinant, Human, His-Tag
049992-02 50 µg

Pyruvate Dehydrogenase Phosphatase 2 (PDP2), Recombinant, Human, His-Tag

Sign In for Pricing
View Details