Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS4A (NM_013245) Human Tagged ORF Clone
RC208099 10 µg

VPS4A (NM_013245) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cebpd (NM_013154) Rat Tagged ORF Clone Lentiviral Particle
RR201147L4V 200 µL

Cebpd (NM_013154) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SNORA36B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2216106 1.0 µg DNA

SNORA36B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Monoclonal WNT5A Antibody, Clone: 3D10
APR10755G 0.1ml

Monoclonal WNT5A Antibody, Clone: 3D10

Sign In for Pricing
View Details
JDP2, 1-163aa, Human His tag, E Coli
MBS205501-01 0.01 mg

JDP2, 1-163aa, Human His tag, E Coli

Sign In for Pricing
View Details
JDP2, 1-163aa, Human His tag, E Coli
MBS205501-02 0.05 mg

JDP2, 1-163aa, Human His tag, E Coli

Sign In for Pricing
View Details