Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CACNG4 Antibody
MBS8242537-01 0.03 mL

Anti-CACNG4 Antibody

Sign In for Pricing
View Details
Anti-CACNG4 Antibody
MBS8242537-02 0.05 mL

Anti-CACNG4 Antibody

Sign In for Pricing
View Details
Anti-CACNG4 Antibody
MBS8242537-03 0.1 mL

Anti-CACNG4 Antibody

Sign In for Pricing
View Details
Anti-CACNG4 Antibody
MBS8242537-04 0.2 mL

Anti-CACNG4 Antibody

Sign In for Pricing
View Details
Anti-CACNG4 Antibody
MBS8242537-05 5x 0.2 mL

Anti-CACNG4 Antibody

Sign In for Pricing
View Details
Kcnd3 Rat shRNA Lentiviral Particle (Locus ID 65195)
TL711535V 500 µL Each

Kcnd3 Rat shRNA Lentiviral Particle (Locus ID 65195)

Sign In for Pricing
View Details