Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-518c-3p miRNA Inhibitor
CIH0279-01 10 nmol

Hsa-miR-518c-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-518c-3p miRNA Inhibitor
CIH0279-02 20 nmol

Hsa-miR-518c-3p miRNA Inhibitor

Sign In for Pricing
View Details
EMID1, NT (EMID1, EMU1, EMI domain-containing protein 1, Emilin and multimerin domain-containing protein 1) (MaxLight 550) discontinued
035060-ML550 100 µL

EMID1, NT (EMID1, EMU1, EMI domain-containing protein 1, Emilin and multimerin domain-containing protein 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Recombinant Rat CD276 Protein, His (Fc)-Avi-tagged
CD276-901R 50 µg

Recombinant Rat CD276 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
RARS2 Rabbit pAb (APR28289N)
APR28289N-01 50 µL

RARS2 Rabbit pAb (APR28289N)

Sign In for Pricing
View Details
RARS2 Rabbit pAb (APR28289N)
APR28289N-02 100 µL

RARS2 Rabbit pAb (APR28289N)

Sign In for Pricing
View Details