Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gstcd sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6485307 1.0 µg DNA

Gstcd sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Mmu-miR-6383 miRNA Mimic
CMM1194-01 5 nmol

Mmu-miR-6383 miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-6383 miRNA Mimic
CMM1194-02 10 nmol

Mmu-miR-6383 miRNA Mimic

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana HVA22-like protein c (HVA22C), partial
MBS7102049 Inquire

Recombinant Arabidopsis thaliana HVA22-like protein c (HVA22C), partial

Sign In for Pricing
View Details
TWIST1 (Twist Homolog 1 (Drosophila), ACS3, BPES2, BPES3, SCS, Twist, bHLHa38) (FITC)
253152-FITC 100 µL

TWIST1 (Twist Homolog 1 (Drosophila), ACS3, BPES2, BPES3, SCS, Twist, bHLHa38) (FITC)

Sign In for Pricing
View Details
Recombinant Syntenin 2 (ST2)
SIPD407Hu01-01 10 µg

Recombinant Syntenin 2 (ST2)

Sign In for Pricing
View Details