Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RT1-A1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV650382 1.0 µg DNA

RT1-A1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PRAK / MK5 Recombinant Rabbit monoclonal Antibody
HA751501 100 µL

PRAK / MK5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human Protein Tyrosine Phosphatase Receptor Type J (PTPRJ) ELISA Kit
RD-PTPRJ-Hu-01 96 Tests

Human Protein Tyrosine Phosphatase Receptor Type J (PTPRJ) ELISA Kit

Sign In for Pricing
View Details
Human Protein Tyrosine Phosphatase Receptor Type J (PTPRJ) ELISA Kit
RD-PTPRJ-Hu-02 48 Tests

Human Protein Tyrosine Phosphatase Receptor Type J (PTPRJ) ELISA Kit

Sign In for Pricing
View Details
Ginsenoside F2 10mM * 1mL in DMSO
A14502-10mM-D 10 mM x 1mL in DMSO

Ginsenoside F2 10mM * 1mL in DMSO

Sign In for Pricing
View Details
ZymoPURE™ Wash 2 (Concentrate) (23 mL)
D4200-6-23 23 mL

ZymoPURE™ Wash 2 (Concentrate) (23 mL)

Sign In for Pricing
View Details