Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-lymphocyte antigen CD20 (MS4A1), partial

Product Specifications

Product Name Alternative

(B-lymphocyte surface antigen B1) (Bp35) (Leukocyte surface antigen Leu-16) (Membrane-spanning 4-domains subfamily A member 1) (CD20)

Abbreviation

Recombinant Human MS4A1 protein, partial

Gene Name

MS4A1

UniProt

P11836

Expression Region

209-297aa

Organism

Homo sapiens (Human)

Target Sequence

AGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes . Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.9 kDa

References & Citations

"CD20 homo-oligomers physically associate with the B cell antigen receptor. Dissociation upon receptor engagement and recruitment of phosphoproteins and calmodulin-binding proteins." Polyak M.J., Li H., Shariat N., Deans J.P. J. Biol. Chem. 283:18545-18552 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR21A (DCAF4) (NM_001163508) Human Tagged ORF Clone
RG228403 10 µg

WDR21A (DCAF4) (NM_001163508) Human Tagged ORF Clone

Sign In for Pricing
View Details
VSIG8, CT (VSIG8, C1orf204, V-set and immunoglobulin domain-containing protein 8) (MaxLight 550) discontinued
043785-ML550 100 µL

VSIG8, CT (VSIG8, C1orf204, V-set and immunoglobulin domain-containing protein 8) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Lentiviral human ZNF880 shRNA (UAS) - Lentiviral human ZNF880 shRNA (UAS, GFP) (100)
GTR15085317 1 Vial

Lentiviral human ZNF880 shRNA (UAS) - Lentiviral human ZNF880 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
[KO Validated] ZEB1 Rabbit pAb
MBS9146309-01 0.02 mL

[KO Validated] ZEB1 Rabbit pAb

Sign In for Pricing
View Details
[KO Validated] ZEB1 Rabbit pAb
MBS9146309-02 0.1 mL

[KO Validated] ZEB1 Rabbit pAb

Sign In for Pricing
View Details
[KO Validated] ZEB1 Rabbit pAb
MBS9146309-03 5x 0.1 mL

[KO Validated] ZEB1 Rabbit pAb

Sign In for Pricing
View Details