Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-lymphocyte antigen CD20 (MS4A1), partial

Product Specifications

Product Name Alternative

(B-lymphocyte surface antigen B1) (Bp35) (Leukocyte surface antigen Leu-16) (Membrane-spanning 4-domains subfamily A member 1) (CD20)

Abbreviation

Recombinant Human MS4A1 protein, partial

Gene Name

MS4A1

UniProt

P11836

Expression Region

209-297aa

Organism

Homo sapiens (Human)

Target Sequence

AGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes . Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.9 kDa

References & Citations

"CD20 homo-oligomers physically associate with the B cell antigen receptor. Dissociation upon receptor engagement and recruitment of phosphoproteins and calmodulin-binding proteins." Polyak M.J., Li H., Shariat N., Deans J.P. J. Biol. Chem. 283:18545-18552 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADM2 Polyclonal Antibody, FITC Conjugated
bs-2985R-FITC-TR 20 µL

ADM2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Anti-Grainyhead-like protein 1/GRHL1 Antibody Picoband® Fluoro647 Conjugated
A07368-1-Fluoro647 100 µg/Vial

Anti-Grainyhead-like protein 1/GRHL1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
BZW2 Antibody Blocking peptide
orb1447784 500 µg

BZW2 Antibody Blocking peptide

Sign In for Pricing
View Details
Mouse BLZF1 siRNA
abx909156-01 15 nmol

Mouse BLZF1 siRNA

Sign In for Pricing
View Details
Mouse BLZF1 siRNA
abx909156-02 30 nmol

Mouse BLZF1 siRNA

Sign In for Pricing
View Details
LOC689749 3'UTR Luciferase Stable Cell Line
TU211973 1.0 mL

LOC689749 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details