Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTN4RL1/NgR3, Human (HEK293, His)

The RTN4RL1/NgR3 protein is a cell surface receptor that functionally affects postnatal brain development and axonal regeneration in the adult central nervous system. It aids in axonal migration across the midline of the brain and formation of the corpus callosum. RTN4RL1/NgR3 Protein, Human (HEK293, His) is the recombinant human-derived RTN4RL1/NgR3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RTN4RL1/NgR3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuregulin-3-nrg3-protein-human-395a-a-hek293-his.html

Purity

95.0

Smiles

CPRDCVCYPAPMTVSCQAHNFAAIPEGIPVDSERVFLQNNRIGLLQPGHFSPAMVTLWIYSNNITYIHPSTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGVFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGPGTFRGLVNLDRLLLHENQLQWVHHKAFHDLRRLTTLFLFNNSLSELQGECLAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRGSSSAVPCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQA

Molecular Formula

146760 (Gene_ID) Q86UN2 (C25-A419) (Accession)

Molecular Weight

Approximately 63.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCP2 Protein (N-His, Human)
P505583 100 µg

LCP2 Protein (N-His, Human)

Sign In for Pricing
View Details
mLf1 (NM_001039543) Mouse Tagged ORF Clone Lentiviral Particle
MR203830L4V 200 µL

mLf1 (NM_001039543) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C1qb 3'UTR Lenti-reporter-Luc Vector
14241086 1.0 µg

C1qb 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Etnk2-set siRNA/shRNA/RNAi Lentivector (Rat)
19526096 4x 500 ng

Etnk2-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
SALL4P6 Adenovirus (Human)
42987051 1.0 mL

SALL4P6 Adenovirus (Human)

Sign In for Pricing
View Details
Lentiviral human ADCY2 sgRNA gene knockout kit - Lentiviral human ADCY2 sgRNA gene knockout kit (100)
GTR15393433 1 Vial

Lentiviral human ADCY2 sgRNA gene knockout kit - Lentiviral human ADCY2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details