Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytochrome c/CYCS, Human (His)

Cytochrome c/CYCS protein is a conserved heme-containing protein, and its core function is electron transport. Cytochrome c is widely involved in physiological processes such as aerobic/anaerobic respiration, apoptosis, and antioxidation. Cytochrome c/CYCS Protein, Human (His) is the recombinant Cytochrome c/CYCS protein expressed by E. coli and carries a C-terminal 6*His tag[1].

Product Specifications

Product Name Alternative

Cytochrome c/CYCS Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytochrome-c-cycs-protein-human-his.html

Purity

98.0

Smiles

GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Molecular Formula

54205 (Gene_ID) P99999 (G2-E105) (Accession)

Molecular Weight

Approximately 16.0 kDa

References & Citations

[1]Bertini I, et al. Cytochrome c: occurrence and functions. Chem Rev. 2006 Jan;106 (1) :90-115.|[2]Zhivotovsky B, et al. Injected cytochrome c induces apoptosis. Nature. 1998 Jan 29;391 (6666) :449-50.|[3]Platoshyn O, et al. Cytochrome c activates K+ channels before inducing apoptosis. Am J Physiol Cell Physiol. 2002 Oct;283 (4) :C1298-305.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL
BNC740679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-100 1x 100 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details