Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Potassium voltage-gated channel subfamily E member 2 (KCNE2)

Product Specifications

CAS Number

9000-83-3

Gene Name

KCNE2

UniProt

Q9Y6J6

Expression Region

1-123aa

Organism

Homo sapiens

Target Sequence

MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP

Tag

N-terminal 10xHis-tagged

Source

in vitro E.coli expression system

Field of Research

Others

Assay Type

CF Transmembrane Protein & In Stock Protein

Relevance

Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with HCN1 and HCN2 and increase potassium current. Interacts with KCNQ1; forms a heterooligomer complex leading to currents with an apparently instantaneous activation, a rapid deactivation process and a linear current-voltage relationship and decreases the amplitude of the outward current (PubMed:11101505).

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.3 kDa

References & Citations

"KCNE2 confers background current characteristics to the cardiac KCNQ1 potassium channel." Tinel N., Diochot S., Borsotto M., Lazdunski M., Barhanin J. EMBO J. 19:6326-6330 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 14,15-dihydroxy-eicosatrienoic acid ELISA Kit
MBS7275663-01 48 Well

Human 14,15-dihydroxy-eicosatrienoic acid ELISA Kit

Sign In for Pricing
View Details
Human 14,15-dihydroxy-eicosatrienoic acid ELISA Kit
MBS7275663-02 96 Well

Human 14,15-dihydroxy-eicosatrienoic acid ELISA Kit

Sign In for Pricing
View Details
Human 14,15-dihydroxy-eicosatrienoic acid ELISA Kit
MBS7275663-03 5x 96 Well

Human 14,15-dihydroxy-eicosatrienoic acid ELISA Kit

Sign In for Pricing
View Details
Human 14,15-dihydroxy-eicosatrienoic acid ELISA Kit
MBS7275663-04 10x 96 Well

Human 14,15-dihydroxy-eicosatrienoic acid ELISA Kit

Sign In for Pricing
View Details
3,4-Dibenzyloxyphenethylamine hydrochloride
sc-226216 5 g

3,4-Dibenzyloxyphenethylamine hydrochloride

Sign In for Pricing
View Details
Fibroblast Growth Factor-21 (FGF-21) (UNQ3115/PRO10196)
MBS606888-01 0.1 mg

Fibroblast Growth Factor-21 (FGF-21) (UNQ3115/PRO10196)

Sign In for Pricing
View Details