Cystatin C/CST3, Mouse (HEK293, His)
Cystatin C (CST3), an inhibitor of cysteine proteinases, acts as a local regulator, playing a vital role in modulating proteolytic processes by inhibiting cysteine proteinases within specific cellular environments. Cystatin C/CST3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Cystatin C/CST3 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cystatin-c-protein-mouse-hek293-his.html
Purity
96.30
Smiles
ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA
Molecular Formula
13010 (Gene_ID) P21460 (A21-A140) (Accession)
Molecular Weight
Approximately 16-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Recombinant Shigella dysenteriae serotype 1 Nickel/cobalt efflux system rcnA (rcnA)
Recombinant Shigella dysenteriae serotype 1 Nickel/cobalt efflux system rcnA (rcnA)
RSK1, phosphorylated (Ser364) (Ribosomal S6 Kinase 1, RSK-1, 90kD Ribosomal Protein S6 Kinase 1, p90-RSK 1, p90RSK1, p90S6K, MAP Kinase-activated Protein Kinase 1a, MAPK-activated Protein Kinase 1a, MAPKAP Kinase 1a, MAPKAPK1A, MAPKAPK-1a, Ribosomal Protein S6 Kinase alpha-1, RPS6KA1, S6K-alpha-1) (MaxLight 750) discontinued
