IL-10R beta, Rat (HEK293, Fc)
IL-10R beta protein is an IL10 cytokine surface receptor involved in IL10-mediated inflammation and immune regulation, as well as viral defense responses.IL-10R beta Protein, Rat (HEK293, Fc) is expressed by HEK 293 cells and consists of 351 amino acids (M1-V351) with a Fc tag at the C-terminus[3].
Product Specifications
Product Name Alternative
IL-10R beta Protein, Rat (HEK293, Fc), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-10r-beta-protein-rat-hek293-fc.html
Purity
95.00
Smiles
MIPPPENVRMNSVNFKNILQWEVPAFPKENLTFTAQYESYWYFQDRCKNTASTHCDFSVLSKYGDHTVRVRTELADEHSEWVNVTFCPVEDTIIGPPEMQTESLADSIHMRFSAPQIENEPETWTMKNIYNSWAYRVQYWKNGTKEKFQVTSQYDSEVLRDLEPWTTYCIQVQGFLLDQNRTGEWSKPVCERTTSDETTPP
Molecular Formula
304091 (Gene_ID) NP_001100581.1 (M22-P222) (Accession)
Molecular Weight
Approximately 68 kDa.
References & Citations
[1]Sung-Il Yoon, et al. Structure and mechanism of receptor sharing by the IL-10R2 common chain. Structure. 2010 May 12;18 (5) :638-48.|[2]J Shi, et al. IL10 inhibits starvation-induced autophagy in hypertrophic scar fibroblasts via cross talk between the IL10-IL10R-STAT3 and IL10-AKT-mTOR pathways. Cell Death Dis. 2016 Mar 10;7 (3) :e2133.|[3]Paul Sheppard, et al. IL-28, IL-29 and their class II cytokine receptor IL-28R. Nat Immunol. 2003 Jan;4 (1) :63-8.|[4]Jianyong Fan, et al. The expression of β-Defensin-2, IL-22, IL-22R1 and IL-10R2 in rat model of Klebsiella pneumonia and their correlation with histological grades. Exp Lung Res. 2020 May-Jun;46 (5) :109-116.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP2-04776 0.1 mg
TMEM107 Overexpression Lysate (Native) - (Dry Ice)
Sign In for Pricing
View Details MBS6238132-01 0.1 mL
FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (mammary-Derived Growth Inhibitor), FABP11, H-FABP, MDGI, O-FABP) (MaxLight 750)
Sign In for Pricing
View Details MBS6238132-02 5x 0.1 mL
FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (mammary-Derived Growth Inhibitor), FABP11, H-FABP, MDGI, O-FABP) (MaxLight 750)
Sign In for Pricing
View Details