Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDAR, Mouse (HEK293, Fc)

EDAR protein is a receptor for the EDA isoform TAA, which, unlike TA-2, may activate the NF-kappa-B and JNK pathways, indicating its involvement in immune signaling. In addition, EDAR may cause caspase-independent cell death. EDAR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EDAR protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EDAR Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/edar-protein-mouse-hek-293-fc.html

Purity

97.49

Smiles

EDSNCGENEYHNQTTGLCQQCPPCRPGEEPYMSCGYGTKDDDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGVSAHSSSTSGGSTLSPFQHAHKELSGQGHLATALI

Molecular Formula

13608 (Gene_ID) Q9R187 (E27-I189) (Accession)

Molecular Weight

58-74 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Npepl1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
32050114 3x 1.0 µg

Npepl1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
FGFR-4 HDR Plasmid (h)
sc-400399-HDR 20 µg

FGFR-4 HDR Plasmid (h)

Sign In for Pricing
View Details
QRFP Adenovirus (Mouse)
38269054 1.0 mL

QRFP Adenovirus (Mouse)

Sign In for Pricing
View Details
Forkhead Box L1 (FOXL1) Antibody
abx339993-01 50 µL

Forkhead Box L1 (FOXL1) Antibody

Sign In for Pricing
View Details
Forkhead Box L1 (FOXL1) Antibody
abx339993-02 100 µL

Forkhead Box L1 (FOXL1) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal DDX17 Antibody [Alexa Fluor 647]
NB200-352AF647 100 µL

Rabbit Polyclonal DDX17 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details