Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Decorin/PGS2, Mouse (HEK293, His)

Decorin/PGS2 protein, influencing fibril formation rate, binds strongly to type I and type II collagen, fibronectin, and TGF-beta. It participates in extracellular matrix organization by forming a ternary complex with MFAP2 and ELN, and interacts with DPT, potentially modulating matrix assembly and structure. Decorin/PGS2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Decorin/PGS2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Decorin/PGS2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/decorin-pgs2-protein-mouse-hek-293-his.html

Purity

98.00

Smiles

GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK

Molecular Formula

13179 (Gene_ID) P28654 (G17-K354) (Accession)

Molecular Weight

Approximately 41-50 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS507116 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Docosahexaenoic Acid N-Succinimide
TRC-D494595-25MG 25 mg

Docosahexaenoic Acid N-Succinimide

Sign In for Pricing
View Details
Ribonuclease 3 Rabbit Polyclonal Antibody
R1511-19 100 µL

Ribonuclease 3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RGS9 Antibody
KC-28543-01 50 μL

RGS9 Antibody

Sign In for Pricing
View Details
RGS9 Antibody
KC-28543-02 100 µL

RGS9 Antibody

Sign In for Pricing
View Details
RGS9 Antibody
KC-28543-03 1 mL

RGS9 Antibody

Sign In for Pricing
View Details