Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor protein (TNF), partial (Active)

Product Specifications

Product Name Alternative

Cachectin, Tumor necrosis factor ligand superfamily member 2, TNF-a, , NTF

Abbreviation

Recombinant Human TNF protein, partial (Active)

Gene Name

TNF

UniProt

P01375

Expression Region

87-233aa

Organism

Homo sapiens (Human)

Target Sequence

MRKR+KPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAF

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Cancer

Relevance

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Upregulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208) . Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line (PubMed:22517918) . {ECO:0000269|PubMed:16829952, ECO:0000269|PubMed:22517918, ECO:0000269|PubMed:23396208}.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells. {ECO:0000269|PubMed:16829952}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>98% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 0.01 ng/ml, corresponding to a specific activity of > 1.0 x 10^7 IU/mg in the presence of actinomycin D.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, pH 7.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Upregulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transcription factor COE1 Antibody (Fluoro594)
orb3156154 100 µg

Transcription factor COE1 Antibody (Fluoro594)

Sign In for Pricing
View Details
SOX10 Rabbit pAb, Cy7 conjugated
orb3183660 100 µL

SOX10 Rabbit pAb, Cy7 conjugated

Sign In for Pricing
View Details
Rabbit anti-human Non-specific lipid-transfer protein polyclonal Antibody
MBS7004377-01 0.05 mg

Rabbit anti-human Non-specific lipid-transfer protein polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Non-specific lipid-transfer protein polyclonal Antibody
MBS7004377-02 0.1 mg

Rabbit anti-human Non-specific lipid-transfer protein polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Non-specific lipid-transfer protein polyclonal Antibody
MBS7004377-03 5x 0.1 mg

Rabbit anti-human Non-specific lipid-transfer protein polyclonal Antibody

Sign In for Pricing
View Details
ZNF529 Antibody
orb26596-01 50 µg

ZNF529 Antibody

Sign In for Pricing
View Details