Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DSP, Human (His-SUMO)

DSP proteins are major components of desmosomes and are critical for the structural integrity of various tissues. In cardiomyocytes, DSP regulates profibrotic gene expression through MAPK14/p38 MAPK activation and increased TGFB1 protein. DSP Protein, Human (His-SUMO) is the recombinant human-derived DSP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

DSP Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dsp-protein-human-his-sumo.html

Purity

97.00

Smiles

CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD

Molecular Formula

1832 (Gene_ID) P15924 (C78-D300) (Accession)

Molecular Weight

Approximately 42.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 650)
MBS6357084-01 0.1 mL

TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 650)

Ask
View Details
TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 650)
MBS6357084-02 5x 0.1 mL

TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 650)

Ask
View Details
Anti-PKN2 Antibody (1A177)
MF-0083047-01 25 µL

Anti-PKN2 Antibody (1A177)

Ask
View Details
Anti-PKN2 Antibody (1A177)
MF-0083047-02 50 µL

Anti-PKN2 Antibody (1A177)

Ask
View Details
Anti-PKN2 Antibody (1A177)
MF-0083047-03 100 µL

Anti-PKN2 Antibody (1A177)

Ask
View Details
Recombinant Human PRPF8 Protein - (Dry Ice)
H00010594-P01-2ug 2 µg

Recombinant Human PRPF8 Protein - (Dry Ice)

Ask
View Details