Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DSP, Human (His-SUMO)

DSP proteins are major components of desmosomes and are critical for the structural integrity of various tissues. In cardiomyocytes, DSP regulates profibrotic gene expression through MAPK14/p38 MAPK activation and increased TGFB1 protein. DSP Protein, Human (His-SUMO) is the recombinant human-derived DSP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

DSP Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dsp-protein-human-his-sumo.html

Purity

97.00

Smiles

CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD

Molecular Formula

1832 (Gene_ID) P15924 (C78-D300) (Accession)

Molecular Weight

Approximately 42.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Exosome Component 2 (EXOSC2) Antibody
abx172308 1 mL

Exosome Component 2 (EXOSC2) Antibody

Ask
View Details
Lentiviral human KIF22 sgRNA gene knockout kit - Lentiviral human KIF22 sgRNA gene knockout kit (plasmid)
GTR15396620 1 Vial

Lentiviral human KIF22 sgRNA gene knockout kit - Lentiviral human KIF22 sgRNA gene knockout kit (plasmid)

Ask
View Details
ZBT24 (ZBTB24) (NM_001164313) Human Tagged Lenti ORF Clone
RC228265L4 10 µg

ZBT24 (ZBTB24) (NM_001164313) Human Tagged Lenti ORF Clone

Ask
View Details
Mouse Monoclonal Monkeypox Virus A29L Antibody (0027) [Alexa Fluor 532]
NBP3-18270AF532 0.1 mL

Mouse Monoclonal Monkeypox Virus A29L Antibody (0027) [Alexa Fluor 532]

Ask
View Details
GUCA1B, NT (GUCA1B, GCAP2, Guanylyl cyclase-activating protein 2, Guanylate cyclase activator 1B) (MaxLight 405) discontinued
036381-ML405 100 µL

GUCA1B, NT (GUCA1B, GCAP2, Guanylyl cyclase-activating protein 2, Guanylate cyclase activator 1B) (MaxLight 405) discontinued

Ask
View Details