Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DSP, Human (His-SUMO)

DSP proteins are major components of desmosomes and are critical for the structural integrity of various tissues. In cardiomyocytes, DSP regulates profibrotic gene expression through MAPK14/p38 MAPK activation and increased TGFB1 protein. DSP Protein, Human (His-SUMO) is the recombinant human-derived DSP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

DSP Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dsp-protein-human-his-sumo.html

Purity

97.00

Smiles

CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD

Molecular Formula

1832 (Gene_ID) P15924 (C78-D300) (Accession)

Molecular Weight

Approximately 42.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tpsab1 (NM_031187) Mouse Tagged Lenti ORF Clone
MR203662L4 10 µg

Tpsab1 (NM_031187) Mouse Tagged Lenti ORF Clone

Ask
View Details
URGCP Protein Lysate (Human) with C-Ha Tag
49248031 100 µg

URGCP Protein Lysate (Human) with C-Ha Tag

Ask
View Details
ERO1L (ERO1-like Protein alpha, ERO1-L, ERO1-L-alpha, Endoplasmic Oxidoreductin-1-like Protein, Oxidoreductin-1-L-alpha, UNQ434/PRO865) (MaxLight 490)
126446-ML490 100 µL

ERO1L (ERO1-like Protein alpha, ERO1-L, ERO1-L-alpha, Endoplasmic Oxidoreductin-1-like Protein, Oxidoreductin-1-L-alpha, UNQ434/PRO865) (MaxLight 490)

Ask
View Details
PSMB8 (Proteasome (Prosome, Macropain) Subunit, beta Type, 8 (Large multifunctional Peptidase 7), D6S216, D6S216E, LMP7, MGC1491, PSMB5i, RING10, beta5i) (HRP)
250584-HRP 100 µL

PSMB8 (Proteasome (Prosome, Macropain) Subunit, beta Type, 8 (Large multifunctional Peptidase 7), D6S216, D6S216E, LMP7, MGC1491, PSMB5i, RING10, beta5i) (HRP)

Ask
View Details
Lentiviral human UVRAG sgRNA gene knockout kit - Lentiviral human UVRAG sgRNA gene knockout kit (100)
GTR15398617 1 Vial

Lentiviral human UVRAG sgRNA gene knockout kit - Lentiviral human UVRAG sgRNA gene knockout kit (100)

Ask
View Details