Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DSP, Human (His-SUMO)

DSP proteins are major components of desmosomes and are critical for the structural integrity of various tissues. In cardiomyocytes, DSP regulates profibrotic gene expression through MAPK14/p38 MAPK activation and increased TGFB1 protein. DSP Protein, Human (His-SUMO) is the recombinant human-derived DSP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

DSP Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dsp-protein-human-his-sumo.html

Purity

97.00

Smiles

CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD

Molecular Formula

1832 (Gene_ID) P15924 (C78-D300) (Accession)

Molecular Weight

Approximately 42.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Wilms Tumor Protein Rabbit pAb
GB11382-50 50 μL

Anti-Wilms Tumor Protein Rabbit pAb

Ask
View Details
ZW10 (Centromere/kinetochore Protein zw10 Homolog, zw10 Kinetochore Protein, HZW10, KNTC1AP) (MaxLight 490)
135844-ML490 100 µL

ZW10 (Centromere/kinetochore Protein zw10 Homolog, zw10 Kinetochore Protein, HZW10, KNTC1AP) (MaxLight 490)

Ask
View Details
AGFG1, NT (AGFG1, HRB, RAB, RIP, Arf-GAP domain and FG repeat-containing protein 1, HIV-1 Rev-binding protein, Nucleoporin-like protein RIP, Rev-interacting protein, Rev/Rex activation domain-binding protein) (PE) discontinued
031694-PE 200 µL

AGFG1, NT (AGFG1, HRB, RAB, RIP, Arf-GAP domain and FG repeat-containing protein 1, HIV-1 Rev-binding protein, Nucleoporin-like protein RIP, Rev-interacting protein, Rev/Rex activation domain-binding protein) (PE) discontinued

Ask
View Details
Rap1a-set siRNA/shRNA/RNAi Lentivector (Mouse)
38494094 4x 500 ng

Rap1a-set siRNA/shRNA/RNAi Lentivector (Mouse)

Ask
View Details
Galectin 3 Monoclonal Antibody, AbBy Fluor™ 680 Conjugated
bsm-33049M-BF680 100 µL

Galectin 3 Monoclonal Antibody, AbBy Fluor™ 680 Conjugated

Ask
View Details