Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 8, Mouse (His)

Despite its name, the carbonic anhydrase VIII (CA8) protein lacks carbonic anhydrase catalytic activity. This distinguishes CA8 from its typical functions related to carbonic anhydrase, an enzyme known for its ability to catalyze the reversible hydration of carbon dioxide. Carbonic Anhydrase 8 Protein, Mouse (His) is the recombinant mouse-derived Carbonic Anhydrase VIII/CA8 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 8 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-viii-ca8-protein-mouse-his.html

Purity

98.00

Smiles

MADLSFIEDAVAFPEKEEDEEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGQEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Molecular Formula

12319 (Gene_ID) P28651 (M1-Q291) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

C1qbp Rat shRNA Plasmid (Locus ID 29681)
TL710270 1 Kit

C1qbp Rat shRNA Plasmid (Locus ID 29681)

Ask
View Details
Cat Disks Large Homolog 5 (DLG5) ELISA Kit
MBS9398418 Inquire

Cat Disks Large Homolog 5 (DLG5) ELISA Kit

Ask
View Details
Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)
MBS2089683-01 5x 96 Tests

Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)

Ask
View Details
Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)
MBS2089683-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)

Ask
View Details
Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)
MBS2089683-03 10x 96 Tests

Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)

Ask
View Details
Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)
MBS2089683-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)

Ask
View Details