Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Trichohyalin (TCHH), partial

Product Specifications

Abbreviation

Recombinant Human TCHH protein, partial

Gene Name

TCHH

UniProt

Q07283

Expression Region

1854-1943aa

Organism

Homo sapiens (Human)

Target Sequence

QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEYIQEQRSQYRP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Intermediate filament-associated protein that associates in regular arrays with keratin intermediate filaments (KIF) of the inner root sheath cells of the hair follicle and the granular layer of the epidermis. It later becomes cross-linked to KIF by isodipeptide bonds. It may serve as scaffold protein, together with involucrin, in the organization of the cell envelope or even anchor the cell envelope to the KIF network. It may be involved in its own calcium-dependent postsynthetic processing during terminal differentiation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.6 kDa

References & Citations

"The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R. Nature 441:315-321 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock protein mitochondrial, Chaperonin, 60-KD (CPN60), GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix protein P1, P60 lymphocyte protein, Short heat shock protein 60 Hsp60s1, Spastic paraplegia 13 (SPG13) ) (FITC)
168799-AF-FITC 100 µL

HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock protein mitochondrial, Chaperonin, 60-KD (CPN60), GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix protein P1, P60 lymphocyte protein, Short heat shock protein 60 Hsp60s1, Spastic paraplegia 13 (SPG13) ) (FITC)

Ask
View Details
TSC1, Phosphorylated (S555) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 650)
MBS6359053-01 0.1 mL

TSC1, Phosphorylated (S555) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 650)

Ask
View Details
TSC1, Phosphorylated (S555) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 650)
MBS6359053-02 5x 0.1 mL

TSC1, Phosphorylated (S555) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 650)

Ask
View Details
Recombinant Human FAM72A Protein
E30P7810 20 µg

Recombinant Human FAM72A Protein

Ask
View Details
WDR11 CRISPRa sgRNA lentivector (set of three targets)(Human)
50299121 3x 1.0µg DNA

WDR11 CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
Recombinant Hoplosternum littorale Hemoglobin cathodic subunit beta (hbb)
MBS1160054-01 0.02 mg (E-Coli)

Recombinant Hoplosternum littorale Hemoglobin cathodic subunit beta (hbb)

Ask
View Details