Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INADL Peptide-N-terminal region

Product Specifications

Gene Name

[INADL]

NCBI Gene ID

10207

Reactivity

Human

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Other Gene Names

[INADL; PATJ; Inadl protein; hINADL]

Short Name

[INADL]

Other Product Names

[InaD-like protein; Pals1-associated tight junction protein; Protein associated to tight junctions]

NCBI Accession Number

NM_176877.4

Uniprot Accession Number

Q8NI35

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat MART/Melan-A ELISA Kit
ERM0236 96 Tests

Rat MART/Melan-A ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody to S1-tag
45-1021-40 40 µg

Rabbit Polyclonal Antibody to S1-tag

Sign In for Pricing
View Details
VIP1 Rabbit Polyclonal Antibody
JOT-AP13445-01 50ul

VIP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VIP1 Rabbit Polyclonal Antibody
JOT-AP13445-02 100ul

VIP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
MBS5818107 Inquire

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Sign In for Pricing
View Details
Rabbit Anti-Human Inhibin beta A mAb
MA1252-01 50 μL

Rabbit Anti-Human Inhibin beta A mAb

Sign In for Pricing
View Details