Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAP1, Human (HEK293, His)

Proline-rich acidic protein 1 (PRAP1) is a lipid-binding protein which promotes lipid absorption; negatively regulates the apoptotic process; gets involved in p53/TP53-dependent cell survival after DNA damage; causes cell cycle arrest; maintains normal growth homeostasis in epithelial cells and suppress mitotic spindle assembly checkpoint in hepatocellular carcinomas. PRAP1 Protein, Human (HEK293, His) is the recombinant human-derived PRAP1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PRAP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prap1-protein-human-hek-293-his.html

Purity

97.08

Smiles

VPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ

Molecular Formula

118471 (Gene_ID) Q96NZ9/AAL16670.1 (V21-Q151) (Accession)

Molecular Weight

Approximately 20.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EnzyFluo™ Farnesyltransferase Inhibitor Screening Kit
EIFT-400 400 Tests

EnzyFluo™ Farnesyltransferase Inhibitor Screening Kit

Sign In for Pricing
View Details
RYMV Goat Polyclonal Antibody
AB0146-200 600 µg

RYMV Goat Polyclonal Antibody

Sign In for Pricing
View Details
Adam23 Mouse Gene Knockout Kit (CRISPR)
KN500827 1 Kit

Adam23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPR103 (QRFPR) (NM_198179) Human Over-expression Lysate
LC403681 20 µg

GPR103 (QRFPR) (NM_198179) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS642605 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR560006 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details