What is the catalog number for CD70, Mouse (HEK293, mFc)?

The catalog number for CD70, Mouse (HEK293, mFc) is HY-P72928.

What sizes are available for CD70, Mouse (HEK293, mFc)?

CD70, Mouse (HEK293, mFc) is available in the following size(s): 50 µg.

Is CD70, Mouse (HEK293, mFc) in stock?

CD70, Mouse (HEK293, mFc) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures CD70, Mouse (HEK293, mFc)?

CD70, Mouse (HEK293, mFc) is manufactured by QuantiMol.

What is the estimated delivery time for CD70, Mouse (HEK293, mFc)?

Estimated delivery time for CD70, Mouse (HEK293, mFc) is approximately 15 business day(s), depending on your location.

CD70, Mouse (HEK293, mFc)

CD70 is the ligand of CD27 in activated T and B lymphocytes, is an important cytokine in CD70-CD27 pathway involving with the generation and maintenance of T cell immunity[1]. CD70 is a surface antigen, also shows antiviral activity and regulates viability of tumor cells and regulatory T cells[2][3]. As for CD70 protein in mouse contains TNF_2 domain (60-190 a.a) and transmembrane helix, belonging to the tumor necrosis factor (TNF) family. CD70 Protein, Mouse (HEK293, mFc) is 149 amino acids in length (Q47-P195) and is expressed in the HEK293 cells with N terminal mFc-tag.

Product Specifications

Product Name Alternative

CD70 Protein, Mouse (HEK293, mFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd70-protein-mouse-hek293-fc.html

Purity

96.80

Smiles

QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP

Molecular Formula

21948 (Gene_ID) Q05A52 (Q47-P195) (Accession)

Molecular Weight

Approximately 43.1 kDa

References & Citations

[1]Bowman MR, et al. The cloning of CD70 and its identification as the ligand for CD27. J Immunol. 1994 Feb 15;152 (4) :1756-61.|[2]Jacobs J, et al. CD70: An emerging target in cancer immunotherapy. Pharmacol Ther. 2015 Nov;155:1-10.|[3]Izawa K, et al. Inherited CD70 deficiency in humans reveals a critical role for the CD70-CD27 pathway in immunity to Epstein-Barr virus infection. J Exp Med. 2017 Jan;214 (1) :73-89.|[4]Brown GR, et al. CD27-CD27 ligand/CD70 interactions enhance alloantigen-induced proliferation and cytolytic activity in CD8+ T lymphocytes. J Immunol. 1995 Apr 15;154 (8) :3686-95.|[5]Kobata T, et al. CD27-CD70 interactions regulate B-cell activation by T cells. Proc Natl Acad Sci U S A. 1995 Nov 21;92 (24) :11249-53.|[6]Jin L, et al. CD70, a novel target of CAR T-cell therapy for gliomas. Neuro Oncol. 2018 Jan 10;20 (1) :55-65.|[7]Boursalian TE, et al. Targeting CD70 for human therapeutic use. Adv Exp Med Biol. 2009;647:108-19.|[8]Arens R, et al. Signaling through CD70 regulates B cell activation and IgG production. J Immunol. 2004 Sep 15;173 (6) :3901-8.