Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Odorant-binding/OBP, Bovine (P.pastoris)

Odor-binding proteins (OBPs) effectively bind a variety of odorants to form homodimers that enhance their function. OBP is crucial in the olfactory process, playing a key role in capturing odor molecules and contributing to the complex odor perception mechanism. Odorant-binding protein/OBP Protein, Bovine (P.pastoris) is the recombinant bovine-derived Odorant-binding protein/OBP protein, expressed by P. pastoris , with tag free.

Product Specifications

Product Name Alternative

Odorant-binding protein/OBP Protein, Bovine (P.pastoris), Bovine, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/odorant-binding-protein-obp-bovine-p-pastoris.html

Smiles

AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE

Molecular Formula

/ (Gene_ID) P07435 (A1-E159) (Accession)

Molecular Weight

Approximately 34.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-500 1x 500 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF488A conjugate, 0.1mg/mL
BNC882329-100 1x 100 µL

MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF640R conjugate, 0.1mg/mL
BNC401384-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details