Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP4, Human (His-SUMO)

The AQP4 protein forms water-specific channels and is involved in brain water balance and solute transport. AQP4 Protein, Human (His-SUMO) is the recombinant human-derived AQP4 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

AQP4 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aqp4-protein-human-his-sumo.html

Purity

97.00

Smiles

CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Molecular Formula

361 (Gene_ID) P55087-1 (C253-V323) (Accession)

Molecular Weight

Approximately 25-27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Muscarinic acetylcholine receptor M1 (CHRM1) ELISA kit
GTR10386763 96 Well

Canine Muscarinic acetylcholine receptor M1 (CHRM1) ELISA kit

Sign In for Pricing
View Details
Sp8 CRISPR Activation Plasmid (h2)
sc-401546-ACT-2 20 µg

Sp8 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
SLC22A6 3'UTR Luciferase Stable Cell Line
TU023442 1.0 mL

SLC22A6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SDF4 Antibody
40095 100 µL

SDF4 Antibody

Sign In for Pricing
View Details
1,1'- (1,4-Phenylene) bis[2-phenylethanone]
OR1037931-01 100 mg

1,1'- (1,4-Phenylene) bis[2-phenylethanone]

Sign In for Pricing
View Details
1,1'- (1,4-Phenylene) bis[2-phenylethanone]
OR1037931-02 250 mg

1,1'- (1,4-Phenylene) bis[2-phenylethanone]

Sign In for Pricing
View Details